KEGG   Jeongeupia sp. USM3: BJP62_11450Help
Entry
BJP62_11450       CDS       T04552                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00550  Peptidoglycan biosynthesis
jeu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP62_11450
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BJP62_11450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jeu01011]
    BJP62_11450
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:jeu03036]
    BJP62_11450
Enzymes [BR:jeu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BJP62_11450
Peptidoglycan biosynthesis and degradation proteins [BR:jeu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BJP62_11450
Chromosome and associated proteins [BR:jeu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BJP62_11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer IF2_N
Motif
Other DBs
NCBI-ProteinID: AOY02318
UniProt: A0A1D9BIJ8
LinkDB All DBs
Position
2432086..2433957
Genome map
AA seq 623 aa AA seqDB search
MIPPTQARKRYSQQLKLERWRVWFVVAGLMGLFAILLGRGLWLQVFNDEFLQGQGDARYT
RTLRLEANRGMITDRNGEPLAISTPVQSVWASPRSIALLPNGQTRPADWEPENDKDPVPL
SQDEVGKLARALGMPVADVVKKLSEPRRTGKGEVIKDKDGKPSRPDFVWLRRQMNPQDAK
NVMALNIPGVYAQAEFRRYYPAGEIMAQIVGYTNIDGHGQEGLELARDKLLSGQTGSRTV
IRDRRGYIVEDISTIVPPKDGETLALSIDRRIQYLAYRELNKAVSDFGAVGGSIVVLDAR
SGEILALANSPSYNPNSRERIDPSKKRNRAITDLYEPGSTLKPLTIAAAMQAGTINAKTT
FNTSPGALSMGGFTIKDTHNYGVLTPEGIIVHSSNIGSLKVALTMPRETQWNMLNAAGIG
QRPGLGFPGESAGKLRPFKTWYPIEQGTMGYGYGLSVSLMQMAKAYQIFATDGIEHPVSL
IRQTAPMPGKQVISPELARTIRGYMEKVTQPGGTATRAQVVGYRVAGKTGTARKQSGGGY
TDKKYVGSFVGLAPVSNPRLIVAVMIDEPDIKKSIYGGAVAAPVFSSVVAGTLRLLGIPP
DAPTNNILLPSPQDTREDEAWVP
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgccgacccaggcgcgcaagcgctacagccagcagctcaagctcgagcgctgg
cgggtctggttcgtcgtcgccgggctgatggggctgttcgcaatcctgctcggccgcggc
ctgtggctgcaggtgttcaacgatgagttcctgcagggccagggcgatgcgcgctacacg
cgcacgctcaggctcgaggccaaccgcggcatgatcaccgaccgcaacggcgagccgctg
gcgatctcgaccccggtccagtcggtctgggccagcccgcgcagcatcgcgctgctgccg
aacggccagacgcgtccggccgactgggagcccgagaacgacaaggacccggtgccgctg
tcgcaggacgaggtcggtaagctggcgcgtgcgctcggcatgcccgtcgccgacgtggtg
aagaaattgtccgagccgcgccgcaccggcaagggcgaggtgatcaaggacaaggacggc
aagcccagccggcccgatttcgtctggctgcgccggcagatgaacccgcaggacgccaag
aacgtcatggcgctgaacatccccggcgtctacgcgcaggccgagttccgccgctactac
ccggccggcgagatcatggcgcagatcgtcggctataccaatatcgacggccacggtcag
gaagggctcgagctcgcgcgcgacaagctgctgtcgggccagaccggcagccgcacggtg
atccgcgaccggcgcggctacatcgtcgaggacatctcgaccatcgtgccgccgaaggac
ggcgagacgctggcgctgtcgatcgaccggcgcatccagtacctcgcctaccgtgaactg
aacaaggcggtcagcgacttcggcgcggtcggcggcagcatcgtcgtgctcgacgcgcgc
tccggcgaaatcctcgcactggccaactcgccgtcgtacaacccgaacagccgcgaacgg
atcgatccgtcgaagaagcgcaaccgcgcgatcaccgacctgtacgagccgggttcgacg
ctgaagccgctgacgatcgccgcggcgatgcaggccggcacgatcaacgccaagacgacg
ttcaatacctcgcccggcgcgctgtcgatgggcggcttcacgatcaaggacacgcacaac
tacggcgtgctgacgcccgaaggcatcatcgtccattcgagcaacatcggctcgctcaag
gtggcgctgacgatgccgcgcgaaacgcagtggaacatgctcaacgccgccggcatcggc
cagcggccgggcctgggcttcccgggcgaatcggccggcaagctgcggccgttcaagacc
tggtacccgatcgagcagggcaccatgggctacggctacggcctgtcggtcagcctgatg
cagatggccaaggcctaccagatcttcgccaccgacggcatcgagcacccggtcagcctg
atcaggcagacggcgccgatgccgggcaagcaggtgatctcgcccgagctagcacggacg
atccgcggctacatggaaaaggtcacccagcccggcggcaccgcgacacgggcgcaggtc
gtcggctaccgcgtcgccggcaagaccgggaccgcgcgcaagcagagcggcggcggctac
accgacaagaaatacgtcggctccttcgtcggtctggcgccggtatcgaacccgcggctg
atcgtcgcggtgatgatcgacgaaccggacatcaagaaaagcatctacggcggcgcggtc
gccgcaccggtgttctccagcgtcgtcgcaggcaccctgcggctgctgggcattccgccc
gacgcaccgaccaacaacattctgctgccgagtcctcaggacaccagggaggacgaagca
tgggtcccataa

DBGET integrated database retrieval system