KEGG   Jeongeupia sp. USM3: BJP62_11490Help
Entry
BJP62_11490       CDS       T04552                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00473  D-Alanine metabolism
jeu00550  Peptidoglycan biosynthesis
jeu01100  Metabolic pathways
jeu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJP62_11490
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP62_11490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BJP62_11490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jeu01011]
    BJP62_11490
Enzymes [BR:jeu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJP62_11490
Peptidoglycan biosynthesis and degradation proteins [BR:jeu01011]
 Precursor biosynthesis
  Amino acid ligase
   BJP62_11490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 ATP-grasp_3 ATPgrasp_YheCD RimK CPSase_L_D2 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AOY01007
UniProt: A0A1D9BEX5
LinkDB All DBs
Position
2443095..2444006
Genome map
AA seq 303 aa AA seqDB search
MKQYGKVAVVMGGESSEREVSLMSGRGVLEALRSQGVDAHAFDPAEKPLEALHEEGFDRA
FLILHGGDGEDGTIQGALEYLGIPYTGCGVMASAIGMDKWRTKLMWQAVGLPVPAYLLLD
AQSDFESVIPKLGSPVFVKPSNGGSSVGVTKCRTADEIRAAYEEAAKYDPLVMVEQAVSG
GEYSCAVLDGRALATVKIEPATEFYDYDAKYFRDDTVYTCPGLQGEAEAQARVLAEAAYR
VLGATGWARIDFLTDADGKVYLLEPNTAPGMTSHSLFPMCAREAGIGYEQLVLQILDTTL
EAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatacggcaaggtcgccgtggtgatgggcggcgaatcgagcgagcgcgaagtc
tcgctgatgagcggccgtggcgtgctcgaggcactgcgcagccagggcgtcgacgcccat
gcgttcgatccggccgaaaaaccgctcgaggcgctgcacgaggaggggttcgaccgggcc
ttcctgatcctgcacggcggcgacggcgaggacggcacgatccagggcgcgctcgaatac
ctcggcattccgtacacgggctgcggcgtgatggcgagcgcgatcggcatggacaagtgg
cgcaccaagctgatgtggcaggccgtcggcctgccggtgccggcctacctgctgctcgac
gcgcagagcgatttcgaatcggtgatcccgaagctcggctcgccggtgttcgttaaaccg
tcgaacggcggttcgagcgtcggcgtcaccaagtgccgcacagcagacgaaatccgggcc
gcgtacgaggaagccgccaagtacgacccgctggtgatggtcgagcaggccgtgtccggc
ggcgaatacagctgcgcggtgctcgacggccgcgcgctggcgacggtgaagatcgagccg
gcgactgagttctacgactacgacgccaagtacttccgcgacgacaccgtctacacctgc
ccgggtctgcagggcgaagccgaagcgcaggcgcgcgtgctcgccgaagccgcctaccgc
gtgctcggcgcgaccggctgggcgcggatcgacttcctgaccgacgccgacggcaaggtc
tacctgctcgaaccgaacaccgcgccgggcatgaccagccacagcctgttcccgatgtgc
gcgcgcgaagccggcatcggctacgagcagctggtgctgcagatcctcgatacgacgctg
gaggctgaatga

DBGET integrated database retrieval system