KEGG   Jeongeupia sp. USM3: BJP62_15070Help
Entry
BJP62_15070       CDS       T04552                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
jeu  Jeongeupia sp. USM3
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJP62_15070
Enzymes [BR:jeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BJP62_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAM72 ADH_zinc_N_2 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AOY01660
UniProt: A0A1D9BH66
LinkDB All DBs
Position
3177084..3178184
Genome map
AA seq 366 aa AA seqDB search
MSKYQYHEVDMNAVVCHGPKDYRYQKVRRPKAGARELVIKIDACGICASDCKCHSGAAMF
WGSNSTESWVKPPVVPGHEFFGTVVEVGDGADEHFGCKAGERVIAEQIVPCEKCRFCKSG
KYWMCEVHNIFGFQREVAEGGMSDYMRLPSNAVVHKIPDSVSLEDAAIIEPLACAVHTVN
RGDIQLDDVVVIAGAGPIGLMMVQVARLKTPKKLVVIDLVRERLDLALQFGADVVIDPSK
EDAKAIVDALTNGYGCDVYIEATGAPIGVNQGLSLIRKLGRFVEFSVFGKETTADWSIIG
DRKELDIRGAHLGPYCYPIAIDLLDRGLVTSKGIVTHKYTLEEWDTAIKVADSLDSIKVL
LTPNAG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtaccagtatcacgaagtcgacatgaacgccgtcgtctgccacggcccgaag
gactaccgctaccagaaggtccgccgccccaaggccggtgcgcgcgagctggtcatcaag
atcgacgcctgcggcatctgcgccagcgactgcaagtgccattcgggcgcggcgatgttc
tggggcagcaacagcaccgagagctgggtcaagccgccggtggtgccggggcacgagttc
ttcggcaccgtggtcgaggttggcgacggcgccgacgaacacttcggctgcaaggccggc
gagcgcgtgatcgccgagcagatcgtcccgtgcgagaagtgccgcttctgcaagagcggc
aagtactggatgtgcgaggttcacaacatcttcggcttccagcgcgaagtcgccgaaggc
ggcatgtccgactacatgcgcctgccatcgaacgccgtcgtccacaaaattccggattcg
gtatcgctcgaggacgcagcgatcatcgagccgctggcgtgcgcggtgcacacagtcaac
cgcggcgacatccagctcgacgacgtggtggtgatcgccggcgcgggcccgatcgggctg
atgatggtgcaggtcgccagactgaaaacgccgaagaagctggtcgtcatcgatctggtg
cgcgagcggctcgatctggcgctgcagttcggtgccgacgtggtgatcgatccgtcgaag
gaagacgccaaggccatcgtcgatgcgctgaccaacggctacggctgcgatgtctacatc
gaggcgaccggcgcgccgatcggcgtcaaccagggcctgagcctgatccgcaagctcggc
cgtttcgtcgagttctcggtgttcggcaaggaaaccactgccgactggtcgatcatcggc
gaccgcaaggagctggacatccgcggcgcccaccttggcccgtactgctacccgatcgcg
atcgacctgctcgaccgcggcctcgtgacgtcgaagggcatcgttacccacaagtacacg
ctggaagagtgggacaccgcgatcaaggtggccgattcgcttgactcgatcaaggtgctg
ctgacccccaatgcgggctga

DBGET integrated database retrieval system