KEGG   Jeongeupia sp. USM3: BJP62_17500Help
Entry
BJP62_17500       CDS       T04552                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BJP62_17500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:jeu03400]
    BJP62_17500
Enzymes [BR:jeu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BJP62_17500
DNA repair and recombination proteins [BR:jeu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BJP62_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AOY02078
UniProt: A0A1D9BHY5
LinkDB All DBs
Position
complement(3722360..3723220)
Genome map
AA seq 286 aa AA seqDB search
MSRRALDELGLGPIWIRRDQLAALARDAAPEEAQDEPAPGVVIPRPAAPAAAATAGTPSP
AATKASRAPVVVIPDARTRAAPQADIKPAENERSRDIAAMDWETLEASIRACTACALCEG
RTQAVPGVGDRSARLLIVGEAPGAEEDKRGEPFVGAAGKLLDNMLAAIGEKRGDGVYIAN
VLKCRPPGNRNPQPPEVAECAPYLARQIALIRPTVIFAIGRFAIQTLLKTDAPISALRGK
VHRHDETPVVISYHPAYLLRNLPDKAKAWQDLLLLGEQLAATKSGD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcgcgcgctcgacgaactcggcctcgggccgatctggatccgccgcgaccag
cttgcggcactggcccgcgacgcggcgcccgaagaggcccaggacgaaccggcacccggt
gtcgttataccgcggccggccgcaccggctgccgcagcaaccgccggcacaccatccccg
gcagccaccaaggccagccgcgccccggtcgtcgtcattcccgatgcgcgcacccgcgcc
gcgccgcaggccgacatcaagccagccgagaacgagcgcagtcgcgacatcgcggcgatg
gactgggaaacgctcgaggcatcgatccgtgcgtgtaccgcgtgtgcgctgtgcgaaggc
cgtacccaggccgttcccggtgtcggcgaccgcagcgcgcgcctgctgatcgtcggcgaa
gcgcccggtgccgaagaggacaagcgcggcgagcccttcgtcggtgcggccggcaagcta
ctcgacaatatgctcgcggcgatcggcgagaaacgcggcgacggcgtctacatcgccaac
gtgctcaagtgccgcccgccgggcaaccgcaacccgcagccgccggaagtcgccgaatgc
gcgccgtatctggcccggcagatcgcgctgatccggccgacggtgattttcgcgatcggc
cgcttcgccatccagaccctgctcaagaccgatgcaccgatcagcgcgctgcgcggcaag
gtgcaccgccacgacgagactccggtggtgatcagctaccacccggcctatctgctgcgc
aatctgcccgacaaggccaaggcctggcaggatctgctgctgctcggcgagcaactcgcc
gcaacaaaatccggcgactga

DBGET integrated database retrieval system