KEGG   Janibacter limosus: EXU32_04575Help
Entry
EXU32_04575       CDS       T05853                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
jli  Janibacter limosus
Pathway
jli00564  Glycerophospholipid metabolism
jli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EXU32_04575
Enzymes [BR:jli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EXU32_04575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: QBF45601
LinkDB All DBs
Position
941028..942734
Genome map
AA seq 568 aa AA seqDB search
MPNPTPLDPQQRAAAWRRIAEEDLDVLVIGGGVTGAGVALDAATRGLKVALVEQRDFASG
TSSRSSKLFHGGVRYLEQLNFGLVREALKERELMLTRIAPHLVKPVSFLYPLSHPIWERP
YVTAGLTLYDSMGGGRSVPRTKQLTKGGVRRIAPGLKPSVHHGGLLYHDAQCDDARHTLT
VVRTAASYGAAVLNSAKVTGLLHAGERVVGATVLDVESGDEVEVKASVVINCTGVWTDDI
QRMAGGRGRFHVRASKGVHIVVARDRVNSETGLILRTEKSVLFCIPWGTHWIIGTTDTDW
NLSRAHPAATSADIDYILEQINGVLVTPLTRDDIQGVYAGLRPLLAGESEESSQLSREHA
VARPQPGLVSIAGGKYTTYRIMAQDAVDAAREDLSPGVPDSVTEHIPLIGAEGYPALVNQ
LDTLSRRHDLPVWRLTHLLDRYGSLAVDLFHLIDEDRSLATPLVGAEEYLTVEVVYAARH
EATLHLNDLLTRRTRISIETKDRGVLAAQTAGPILAAELGWDEERTHSEVQHYLRRVQAE
IESQQMTEDERADAERTEATDIRTLAKG
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatcctaccccgctcgaccctcagcagcgcgccgcggcctggcgccgcatcgcc
gaagaggacctcgacgtcctcgtcatcggcggtggcgtgaccggtgcaggtgtcgcactg
gacgccgccacccgcggtctcaaggtggctctcgtcgagcaacgcgacttcgcctcgggc
acctcatcgcgatccagcaagctcttccacggcggtgtgcgctacctcgagcagctcaac
ttcgggctcgtccgcgaggcgctcaaggagcgcgagctgatgctcacgcgcatcgcgccc
cacctggtcaagccggtctccttcctctacccgctctcgcacccgatctgggagcggccc
tacgtgaccgcagggctcacgctctacgactcgatgggcggcggccggtcggtgccccgc
accaagcagctgacgaaggggggagtgcggcggatcgcccccggcctcaagccgtcggtc
caccacggcggcctgctctaccacgacgcccagtgcgacgacgctcgtcacaccctgacg
gtcgtgcgtaccgctgcctcctacggagcagccgtcctcaactccgcaaaggtcaccggc
ctgctgcacgcaggtgagcgggtcgtgggtgcgacggtcctcgacgtcgagtcgggcgac
gaggtcgaggtcaaagcctcggtcgtcatcaactgcaccggtgtgtggaccgatgacatc
cagcggatggccggcggccgcggccggttccacgtgcgcgcgagcaagggcgtgcacatc
gtcgtggcccgtgaccgggtcaactccgagacgggtctgatcctgcggacggaaaagtcc
gtcctcttctgcatcccgtggggcacccactggatcatcggcacgaccgacaccgactgg
aacctctcgcgggcacaccctgcggcgacgtccgcggacatcgactacatcctcgagcag
atcaacggcgtcctcgtcacgccgctgacccgcgacgacatccagggcgtctacgccggt
ctgcgcccgctgctggcgggggagtccgaggagtcctcgcagctcagccgagagcacgcg
gtggcccgaccccagccggggctcgtctcgatcgccggcggcaagtacacgacctaccgg
atcatggcgcaggacgccgtcgacgcagcgcgcgaggacctctcgcccggcgtcccggac
agcgtcaccgagcacatcccgctcatcggggcagagggctaccccgccctggtcaaccag
ctcgacaccctcagccgccgccacgacctgcccgtctggcgcctgacgcacctgctcgac
cgctacggctcgctggccgtcgacctcttccacctcatcgacgaggaccgctctctggca
acgccgctggtgggcgccgaggagtacctcactgtcgaggtcgtctacgcggcgcggcac
gaggcgacgctccacctcaacgacctgctgacccgtcgcacccggatctccatcgagacc
aaggaccgcggtgtgctcgccgcccagaccgccggcccgatcctggccgcagagctcggc
tgggacgaggagcggacccactcggaggtgcagcactacctgcgccgggtgcaggccgag
atcgagagccagcagatgaccgaggacgagcgggccgacgccgagcgcaccgaggcgacg
gacatcaggaccttggccaagggctga

DBGET integrated database retrieval system