KEGG   Janibacter limosus: EXU32_10435Help
Entry
EXU32_10435       CDS       T05853                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
jli  Janibacter limosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal SSP160 Sporozoite_P67 Kinase-like
Motif
Other DBs
NCBI-ProteinID: QBF46631
LinkDB All DBs
Position
complement(2187654..2189096)
Genome map
AA seq 480 aa AA seqDB search
MTDDTTPGLIGDRYETVRPIGRGGMGIVWLARDTVLGRQVAVKQIGDFPGESEGETRRAM
REARAAAALNHPNVVAVYDVTEHEGTPWLVMEYVAGPTLASVIRERGPMTPRGAADLGAQ
LAGALAAAHKAGIVHRDVKPANVLIGGGRPKLGDFGIARSGTDDQLTQTGLVTGTPSYMA
PEVAVGDDHGEAADVWALGATIYFAVEGKDAYPSQGNALATLRSIAAHPPRRPDRAGQLE
PVLADMLSRDATRRGSMAQALRRLESIAAGGTGGAPATATHVMPAAAPAAAPAQHHPDPL
AAQGAPRRGGGWLWVLLVAGLVALLVAGIAFAMSRGAGSDGSTGASGTDRTTETTTTSTT
TSGTSTTSSDTTSSTTSGTTSEDAITEAEGRRFVEDYFSTVTSDRDAAWAMLAPERQTNR
AGYDDFWSDIDSVTTSDISVAEASGEVAVTLTYRPKGRDTSVEQHTYDLTRIDGHIRMTR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgacaccacacccgggctgatcggcgaccgctacgagaccgtgcggccgatc
gggcgtggggggatgggcatcgtctggctggcccgcgacacggtgctgggtcgccaggtc
gccgtgaagcagatcggtgacttccccggggagagcgaaggggagacccgtcgcgccatg
cgtgaggcccgggctgcggccgcgctcaaccaccccaacgtggtcgccgtctacgacgtc
accgagcacgagggcactccgtggctggtcatggagtacgtggccggccccaccctggcc
tccgtgatccgcgagcgcggaccgatgactccgaggggggctgccgacctgggcgcgcag
ctcgccggtgccctggcagcggcacacaaggccgggatcgtgcaccgcgatgtcaagccc
gccaacgtcctcatcggcggcggccggcccaagctgggtgacttcggcatcgcgcgctcc
gggaccgatgaccagctgacccagacgggtctcgtgacgggcaccccgagctacatggca
ccggaggtcgccgtcggcgacgaccacggcgaggccgcagacgtctgggcgctcggagcc
acgatctacttcgcggtcgagggcaaggacgcctacccgagccagggcaacgcactggcg
acattgcgcagcatcgccgcgcacccgccacgacggcccgaccgcgccggtcagctcgag
cccgtgctggcggacatgctctcgcgtgacgccacccgtcgtggctcgatggcccaggcc
ttgcgacggctggagagcatcgctgccggagggacgggtggggctcctgccaccgccacg
cacgtgatgccggcggccgcgcctgccgcggctcccgcccagcaccacccggatcccctg
gcggcgcaaggggcgccgcgacggggaggcgggtggttgtgggtgctcctcgtggccggc
ctggtcgcgctgctcgtggcgggcatcgccttcgccatgtccaggggtgccggctctgac
ggctcgacgggggcctcgggcaccgaccggaccaccgagaccacgacgaccagcacgacg
acgagcgggacctcgacgacctcgtccgacacgacgtccagcacgacgtccggcacgacg
tccgaggacgccatcaccgaggccgaggggcgccgcttcgtcgaggactacttctcgacg
gtcacatccgaccgtgacgccgcctgggcgatgctcgcacctgagcggcagaccaaccgg
gcgggttatgacgacttctggagcgacatcgactcggtcacgacgagcgacatcagcgtg
gccgaggcgtccggcgaggtcgccgtgaccctcacctaccggcccaagggccgggacacc
agcgtcgagcagcacacctacgatctgacccgcatcgacggccacatccgcatgaccaga
tga

DBGET integrated database retrieval system