KEGG   Janibacter limosus: EXU32_16730Help
Entry
EXU32_16730       CDS       T05853                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
jli  Janibacter limosus
Pathway
jli00250  Alanine, aspartate and glutamate metabolism
jli00410  beta-Alanine metabolism
jli00640  Propanoate metabolism
jli00650  Butanoate metabolism
jli01100  Metabolic pathways
jli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EXU32_16730
   00650 Butanoate metabolism
    EXU32_16730
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EXU32_16730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EXU32_16730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jli01007]
    EXU32_16730
Enzymes [BR:jli01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EXU32_16730
Amino acid related enzymes [BR:jli01007]
 Aminotransferase (transaminase)
  Class III
   EXU32_16730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QBF47743
UniProt: A0A4P6N0K7
LinkDB All DBs
Position
complement(3471777..3473054)
Genome map
AA seq 425 aa AA seqDB search
MTALSPLLKQATPVTIDHALGSEIFDVDGNRHLDFTAGIGVVSTGHCHPKVVAAAQEQIG
KLIHGQYTTVMHKPLLALVERLNGVLPEHLDSLFFANSGSEALEASLRLSRQATGRPNVI
VFHGGFHGRTVATATMTTSGTRFSAGFSPLMGGVHVAPFPNAYRYGWSEEEATAFALREL
DFILATLTSPQETAAFIVEPVLGEGGYVPGNTAFFQGLRERADKHGILLVMDEVQTGFGR
TGKMFGHQHFDVQPDIITLAKGIASGFPISGIAASQELMSKAWPGSQGGTYGANAVACAA
AVATLDVIEEEGLVANSAERGAQLLEGAKAAAALRDGRGATSSGNGTIGDVRGLGLLVGS
EFTAADGTPDSARAAKAQQLAATKGLLLLTCGAHMNTVRMIPPLVVTAEQVDEALDIWGK
VLAEV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgttgtcccccctgctcaagcaggccacccccgtcacgatcgaccatgccctc
ggcagtgagatcttcgacgtcgatggcaaccgccacctcgacttcaccgccggcatcggc
gtcgtgagcacgggccactgccaccccaaggtggtcgccgccgcgcaggagcagatcggc
aagctcatccacggtcagtacacgaccgtcatgcacaagcccctcctcgcgctggtcgag
cgactcaacggcgtcctgcccgagcacctcgattcgctcttcttcgccaactccggcagc
gaggcgctggaggcctccctgcgcctctcccgccaggcgaccggtcggcccaatgtcatc
gtcttccacggcggcttccacggtcggacggtcgcgaccgcgacgatgacgacctccggc
acccgcttctcggccggcttctcacccctcatgggcggggtgcacgtcgcgcccttcccc
aatgcctaccgctacggctggagcgaggaggaggccaccgccttcgccctcagggagctc
gacttcatcctcgcaacgctcacctcgccgcaggagaccgccgccttcatcgtcgagccc
gtgctgggcgaaggggggtacgtcccgggcaacaccgccttcttccagggtctgcgcgag
cgcgcggacaagcacggcatcctcctggtgatggacgaggtccaaaccggcttcggccgc
accggcaagatgttcggtcaccagcacttcgacgtgcagcccgacatcatcacgctggcc
aaggggatcgcctccggcttccccatctcgggcatcgccgcctcgcaggagctgatgagc
aaggcgtggcccggctcgcagggtggcacctacggcgccaacgcggtggcctgcgctgcc
gctgtcgccaccctcgacgtcatcgaggaggagggcctggtcgccaactccgccgagcgc
ggcgcccagctgctcgagggcgcgaaggccgccgccgcccttcgagacggtcgcggggcg
acctcctcagggaacgggaccatcggtgacgtgcggggcctcggcctgctcgtgggcagc
gagttcaccgccgccgacgggaccccggacagcgcacgggccgcgaaggcccagcagctc
gccgcgaccaagggtctgctgctcctcacctgcggcgcccacatgaacaccgtgcggatg
atcccgccgctcgtcgtcacggccgagcaggtggacgaggccctggacatctggggcaag
gtcctcgcggaggtctga

DBGET integrated database retrieval system