KEGG   Janibacter limosus: EXU32_16945Help
Entry
EXU32_16945       CDS       T05853                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jli  Janibacter limosus
Brite
KEGG Orthology (KO) [BR:jli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EXU32_16945 (ahpF)
Enzymes [BR:jli01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EXU32_16945 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 FAD_binding_3 Thi4 DAO NAD_binding_8 K_oxygenase FMO-like NAD_binding_9 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QBF47780
UniProt: A0A4P6N067
LinkDB All DBs
Position
3515205..3516884
Genome map
AA seq 559 aa AA seqDB search
MALDPNLATQLKAYLDNLREPIELVASLDESPKSAELDELLVEIEGMSGQITRRVAEGSD
LDQRVPSFAITRVSDPAVSVRFAGIPMGHEFTSLVLALLQVGGHPSKASQDLIDQVQGLS
GDHHFETFFSLSCQNCPDVVQALNLMSVLNPGITHTAIDGAVFPTEAEQRGVLAVPTVFH
NGETFGSGRMELAEIVGKVDELSGGDSAARAAEELSAREPYDVLVVGGGPAGASAAIYAA
RKGIRTGLVAERFGGQVLDTMSIENLISVPHTEGPKLAADLERHVTEYDVEMVRSQAAAG
LSAGDDGLTTVDLANGASLSGKTVILATGARWRTMGVPGEEDYRNKGVTFCPHCDGPLFK
GKRIAVIGGGNSGVEAAIDLAGIVGHVTLIEFMDDMRADAVLQRKLRSLPNVEVRLGTKT
TEVIGDGGKVTGLAIEPRDGGEGEQLDLEGVFVQIGLLPNTEWLGDALELSERGEIVIDG
VGRTSLPGVFAAGDCTVEPYKQIVTALGAGSTASLSAFDHLIRTSAPDEESAIAATKAAD
GPLEAGDQIDVPDSVGASA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgatccgaacctcgccacccagctcaaggcatacctcgacaacctgcgcgag
ccgatcgagctcgtcgcctccctcgacgagagccccaagtccgcagagctcgacgagctg
ctcgtcgagatcgagggcatgagcggccagatcacccgccgcgtggccgaagggagcgac
ttggaccagcgcgtcccctccttcgcgatcacccgggtgtccgatcccgccgtctccgtg
cgcttcgccggcatcccgatgggccacgagttcacctcgctcgtcctggccctgctgcag
gtcggcggccacccgagcaaggcctcgcaggacctcatcgaccaggtccagggcctgagc
ggtgaccaccacttcgagaccttcttctcgctgagctgccagaactgcccggacgtcgtc
caggcgctcaacctgatgagcgtgctcaaccccgggatcacgcacaccgccatcgacggc
gcggtcttcccgaccgaggccgagcagcgtggcgtgctcgcggtgcccaccgtcttccac
aacggcgagaccttcggctccggccggatggagctggccgagatcgtcggcaaggtcgac
gagctgtccggtggcgactccgcggcccgcgccgccgaggagctctccgcgcgtgagccc
tacgacgtcctcgtcgtcggtggtggccccgccggcgcgtccgccgcgatctacgccgcg
cgcaagggcatccgcaccgggctcgtcgccgagcgcttcggcgggcaggtcctcgacacg
atgtcgatcgagaacctcatctccgtcccgcacaccgagggccccaagcttgccgctgac
ctcgagcgccacgtcaccgagtacgacgtcgagatggtccgcagccaggccgctgccggg
ctgtccgccggcgacgacggcctgaccacggtcgacctggccaatggcgcgagcctgtcc
ggcaagaccgtcatcctggcgaccggtgcccgctggcgcaccatgggcgtccccggcgag
gaggactaccgcaacaagggcgtcaccttctgcccgcactgcgacggtccgctcttcaag
ggcaagcgcatcgccgtcatcggcggcggcaactccggtgtcgaggccgccatcgacctg
gccggcatcgtcggtcacgtgacgctcatcgagttcatggacgacatgcgcgccgacgcg
gtcctgcagcgcaagctgcgctcgctgcccaatgtcgaggtccgtctggggaccaagacg
accgaggtcatcggagacggtggcaaggtcaccggcctggccatcgagccgcgtgacggc
ggcgagggggagcagctcgacctcgagggcgtcttcgtccagatcggcctgctgcccaac
accgagtggctcggcgacgcgctggagctgtccgagcgcggcgagatcgtcatcgacggt
gtcggccgcaccagcctcccgggtgtcttcgccgcgggcgactgcacggtcgagccctac
aagcagatcgtcacggccctgggtgccggctcgacggcctccctgagcgccttcgaccac
ctcatccgcaccagcgcccccgacgaggagtcggcgatcgccgcgaccaaggcggccgac
ggcccgctcgaggccggcgaccagatcgacgtgcccgactcggtcggcgcctccgcctga

DBGET integrated database retrieval system