KEGG   Janibacter melonis: EEW87_000500Help
Entry
EEW87_000500      CDS       T06451                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jme  Janibacter melonis
Brite
KEGG Orthology (KO) [BR:jme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EEW87_000500 (ahpF)
Enzymes [BR:jme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EEW87_000500 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase Glutaredoxin DeoRC NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QFQ29130
UniProt: A0A5P8FJ69
LinkDB All DBs
Position
2807504..2809183
Genome map
AA seq 559 aa AA seqDB search
MALDAPLATQLKSLLDNLREPVELVAAYDERPKSGELRELLTQIAGMHDLLTLREAEGDE
IGERRPAFRIQRVSAPEVAVTFAGLPLGHEFSSLVLALLQVGGHPVKEDEATLAAARAVQ
GEHHFVTYMSLTCQNCPTVVQALNALAVLNPGVSHTVVEGSLFQDEVEREGVMAVPSMRL
DGESFGSGRMELSEILAKLDDITGGTGSLEAAAALSEREPYDVLVLGGGPAGASAAIYAA
RKGIRTGLVADRFGGQVNDTMSIENLVGTPRTDGPTLAADLERHVHEYDVDLVKGQTASG
ITEAGEDGLVTVDLASGAGLRARSVIIATGARWRTMDVPGEDEYRNKGVTFCPHCDGPLF
KGKDVAVIGGGNSGVEAAIDLAGVVRHVTVVEYLDEMRADEVLQRKLRSLPNVDVELGRR
TTEVAGDGAKVTGLVHEPRDGGDAVTTAVDGVFVQIGLLPSTEWLIGSGVELSERGEVVV
DDRGATSLPGVFAAGDVTTTPYKQIVVALGDGSTAALSAFDHLIRTSAPAGADTTAATKV
ADGDPVDSDPTDVPDIARV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgacgcccccctggccacccagctgaagtccctgctcgacaacctccgcgag
cccgtcgagctcgtcgccgcgtacgacgagcgacccaagtcgggcgagctgcgcgagctc
ctcacgcagatcgcgggcatgcacgacctgctcaccctgcgcgaggccgagggcgacgag
atcggcgagcgccgccccgccttccggatccagcgcgtctccgcgcccgaggtcgcggtg
accttcgcgggcctgcccctcggccacgagttctcctcgctcgtcctcgcgctgctgcag
gtcggcggccacccggtcaaggaggacgaggccaccctcgccgccgcccgtgccgtgcag
ggcgagcaccacttcgtgacgtacatgtcgctcacctgccagaactgcccgacggtcgtc
caggcgctcaacgccctggccgtcctcaacccgggcgtctcccacacggtcgtcgagggc
tccctcttccaggacgaggtcgagcgcgaaggggtcatggccgtcccgtcgatgcgtctg
gacggcgagagcttcggctccggccgcatggagctctccgagatcctcgccaagctcgac
gacatcaccggcggcaccggctcgctcgaggccgccgcggcgctctctgagcgcgagccc
tacgacgtcctcgtcctcggcggtggccccgccggcgcctcggccgcgatctacgccgcc
cgcaaggggatccgcaccggtctcgtcgccgaccgcttcggcgggcaggtcaacgacacg
atgtcgatcgagaacctcgtgggcaccccgcgcaccgacggcccgaccctcgcggccgac
ctcgagcgccacgtccacgagtacgacgtcgacctcgtcaagggccagaccgcgtcgggc
atcaccgaggccggcgaggacggtctcgtcaccgtcgacctcgcctcgggcgccggcctg
cgcgcccgctcggtgatcatcgcgaccggtgcgcgctggcgcaccatggacgtgccgggc
gaggacgagtaccgcaacaagggcgtcaccttctgcccgcactgcgacggcccgctcttc
aagggcaaggacgtcgcggtcatcggcggcggcaactccggcgtcgaggccgcgatcgac
ctcgccggcgtcgtgcgccacgtcaccgtcgtcgagtacctcgacgagatgcgcgccgac
gaggtgctccagcgcaagctgcgctcgctgcccaacgtcgacgtcgagctcggccgccgg
accaccgaggtcgcgggcgacggggcgaaggtcaccggtctcgtccacgagccgcgggac
ggcggcgacgccgtgacgaccgcggtcgacggcgtcttcgtccagatcggtctgctcccg
agcaccgagtggctcatcggcagcggcgtcgagctgagcgagcgcggcgaggtcgtcgtc
gacgaccgcggcgcgacgagcctgccgggcgtcttcgccgccggcgacgtcacgacgacc
ccgtacaagcagatcgtcgtcgccctgggcgacggctcgacggccgcgctgtcggccttc
gaccacctcatccgcacgagcgccccggcgggtgcggacacgacggcggcgacgaaggtc
gccgacggcgacccggtggacagcgacccgaccgacgtgcccgacatcgcccgcgtctga

DBGET integrated database retrieval system