KEGG   Jeotgalibaca porci: G7058_08100
Entry
G7058_08100       CDS       T06496                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
jpo  Jeotgalibaca porci
Pathway
jpo00362  Benzoate degradation
jpo00622  Xylene degradation
jpo00643  Styrene degradation
jpo01100  Metabolic pathways
jpo01120  Microbial metabolism in diverse environments
jpo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:jpo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G7058_08100
   00622 Xylene degradation
    G7058_08100
   00643 Styrene degradation
    G7058_08100
Enzymes [BR:jpo01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     G7058_08100
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Abhydrolase_2 Abhydrolase_4 FSH1 PGAP1 Abhydrolase_3 Esterase
Other DBs
NCBI-ProteinID: QIK51990
LinkDB
Position
1583154..1583987
AA seq 277 aa
MSRPEVGKSVKTGNFTTNYLEVGEKNGGTPLLFIHGSGPGVSAYANWRLVLPLLEDVAHV
YAMDMIGFGFSDKPTGAEVDYGKELWTQQIIDFLDALDIEKVILVGNSFGGSLSFSTALK
VPDRVEKIITMGAMGPQGQIPYGLDQVWGYKGTEEHMVELIDLFTYDKKFATKELAHVRY
EASMEEGFHEAFSSMFPHPRQPSVDNLSFPDETFKKIEHQTLLVHGREDAVVPVTNSERL
IHLLPNAELHIFGGCGHWTQIEKSEEFATLVKNFIKK
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagtagaccagaagtaggaaaaagtgtaaaaacaggtaactttacaacgaactatcta
gaagtaggagaaaagaatggcggtacaccgttactattcattcacggatcaggcccaggt
gtttcagcgtatgctaactggcgtttagtattgccactattagaagatgtggcacacgtg
tatgcaatggatatgatcggcttcggtttctcagacaaaccgacaggtgctgaagtagat
tatggtaaagaactgtggactcaacagattatcgatttcttggatgcactggatatcgaa
aaagtaattctagttggtaactcgttcggtggttcgttatccttctcaacagctctaaaa
gttccagaccgtgttgaaaagattattacaatgggagcaatggggccacaaggacaaatt
ccatacggattagaccaagtttggggttacaaaggaacagaagagcatatggttgaattg
atcgacttgttcacttacgacaagaaatttgcaacgaaagaattggcgcatgtacgttac
gaagcgtcaatggaagaaggattccatgaagcgtttagctccatgttcccacatccacgc
caaccatccgttgataacctttcgttcccggatgagacgttcaagaagattgaacatcaa
acattactggtacacggtcgcgaagatgccgttgttccagtaacaaactcagagcgtttg
attcacttgctgccaaacgcagagctgcatattttcggcggctgcggacactggacgcaa
attgagaaatcagaagagtttgcaacgctggttaagaattttattaagaaataa

DBGET integrated database retrieval system