KEGG   Juglans regia (English walnut): 108981017Help
Entry
108981017         CDS       T05245                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108981017
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:jre03036]
    108981017
Enzymes [BR:jre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108981017
Chromosome and associated proteins [BR:jre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108981017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET DUF5047
Motif
Other DBs
NCBI-GeneID: 108981017
NCBI-ProteinID: XP_018807636
UniProt: A0A2I4DKG0
LinkDB All DBs
Position
Unknown
AA seq 669 aa AA seqDB search
MDSLFPFQDLNMLPDPSATSTTKAALPLLTPKIEPKLEPSDEPLQRQPTPQEPFFSTGTT
LTPYVLSNSEDTPMSSLPMVISSGEDSVYSEFFRVSELFRSAFAKRLQRYGDVDVLDPDS
RAIVPVPQEDGNNHVSTVVSRKKPFQRSAELVRVADLSMEDRRYFRDLIRRTRMIFDSLR
VLSMMEDEKRRLVDGGLSRKVRGDLRAASALRDRDLWLNRDKRIVGSIPGIYIGDLFFFR
MELCVVGLHGQVQAGIDYVPASQSSSGEPIATSIIVSGGYEDDEDTGDVIIYTGHGGQDK
FSRQCAHQKLEGGNLALERSMHYGIEVRVIRGIKYEGGVSSKVYVYDGLYRILDCWFDVG
KSGFGVYKYKLLRMDGQDEMGSSILRFAQSLRTRPLTARPVGYLSLDISMKKENVPVLLF
NDIDTDQEPMYYDYLVKTVFPPYAFHRTGNGTGCECASGCADGCLCAMKNGGEIAYDHNG
ILLRGKPVIFECGPFCRCPPTCRNRVTQKGLRNRLEVFRSRETGWGVRSLDLIQAGAFIC
EYAGVALTRDQAQILSMNGDTLIYPNRFSSRWAEWGDLSQIFTDFVRPTFPSIPPLDFAM
DVSRMRNVACYISHSETPNVLVQFVLYDHNNLMFPHLMLFAMENIPPLRELSLDYGVADE
WTGKLSICN
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggactctcttttccccttccaagacctcaacatgctcccggacccatccgccacgagc
accaccaaggctgctctgcctctgctaacccccaaaatcgagcccaagctcgaaccctca
gacgagccactacaaaggcagccgactcctcaagaaccgttcttttccaccgggaccacc
ctaaccccctacgtcctctccaattcggaggatacccctatgtcctccctgcccatggtc
atttcctccggggaagacagcgtctactccgagtttttccgagtttccgagctctttcgc
tccgcctttgccaagcggttacagcgttacggcgacgttgacgttttggatcccgattct
cgcgcaatcgtgccagtcccacaggaagacggcaacaatcacgtctcaaccgttgtttct
cggaagaagcccttccagcgctccgcggagctcgtccgtgtcgcggatctcagcatggag
gaccgtcgctacttccgcgatctcattcgtcggacccgcatgatctttgactctctccgc
gtcttatccatgatggaggacgagaagcgccgtctcgtggatggcggcctcagtcgcaag
gtccgcggggatctgcgcgccgcctctgccctgcgcgaccgcgatctgtggctcaaccgg
gacaagcgcatcgtcggctccatcccggggatctacatcggtgatttgttcttcttccga
atggaattgtgcgtagtcggcttacatggtcaggtccaagctggaatcgattacgtcccc
gccagccagagctcgagcggcgagccaatagccaccagcataatcgtgtccggtgggtac
gaagacgacgaggacaccggggacgtgataatctacacgggtcacggcgggcaggacaag
ttctcgaggcaatgtgcgcatcaaaagctggagggtgggaatttagcattggagagaagc
atgcattacggaattgaagtgagggttatcagagggatcaaatacgagggcggcgtatcg
agtaaggtttacgtttacgacggcttgtataggattcttgattgttggtttgatgtggga
aagtcgggttttggggtttacaagtataagctgttgagaatggatgggcaggatgagatg
ggtagctccattttaaggtttgctcaaagtctcaggactaggccgttgacggcgaggccc
gtgggttatcttagccttgatatttcgatgaagaaggagaacgtgccggtattgctcttc
aatgacattgatactgatcaggaacctatgtattatgactatcttgtgaagacggtgttt
ccaccgtatgcatttcacaggacggggaatggtactgggtgtgaatgcgcctcgggttgt
gccgatggttgcctttgtgccatgaagaacgggggagagattgcttatgaccacaatggg
attcttttgagagggaagcccgttatttttgaatgtggacccttttgtaggtgccctcct
acttgccggaaccgtgttactcagaaagggttgagaaataggttggaagtgtttaggtcg
agggagacaggttggggagttaggtccttggatttgatacaagctggtgcttttatatgt
gaatatgccggggttgctctgaccagggaccaagctcaaattttgtcgatgaacggtgat
acgttgatttacccaaatcgtttctcgagtagatgggccgaatggggggatttgtctcag
atatttactgattttgtgcgtccaacgtttccctcaattcctccgctggattttgcaatg
gatgtatcgagaatgaggaatgttgcttgttatatcagccatagtgaaactccgaatgtg
ttggtgcagtttgtgctatatgatcacaataacttgatgttccctcaccttatgctgttt
gcaatggagaacatccctcctttgagggagctcagccttgattatggtgtggctgatgaa
tggacggggaagctatctatctgtaactga

DBGET integrated database retrieval system