KEGG   Juglans regia (English walnut): 108981819Help
Entry
108981819         CDS       T05245                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00620  Pyruvate metabolism
jre00710  Carbon fixation in photosynthetic organisms
jre01100  Metabolic pathways
jre01200  Carbon metabolism
Module
jre_M00168  CAM (Crassulacean acid metabolism), dark
jre_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
jre_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
jre_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:jre00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    108981819
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108981819
Enzymes [BR:jre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     108981819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 108981819
NCBI-ProteinID: XP_018808616
UniProt: A0A2I4DN90
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MAARNLVKLASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQDC
YELSAEYEGKHSPQKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADENSATTESDIEETFKRLVGQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNLGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRVHADELHRSSKKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERARHLLANGISDIPEDTTFTNIEQFLEPLELCYRSLCSC
GDRPIADGSLLDFLRQVSTFGLSLVKLDIRQESDRHTDVIDAITKHLGIGSYKEWSEEHR
QEWLLSELRGKRPLFGPDLPKTDEIADVLDTFHVISELSPDNFGAYIISMATAPSDVLAV
ELLQRECHVKKPLRVVPLFEKLADLEAAPAAVARLFSIEWYRNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIKVSKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVIATK
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKNIIEKNIKNLHMLQEMYNQWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEELWSFGEHLRANHEETKQLLLQIAGHKDLLEGDPYLRQRLRLRDSYITTLNVCQA
YTLKRIRDPDYHVKVRPHLSKEYTESSKPAAELVKLNPMSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcggaacttggtgaagttggcttcaattgatgctcaattgaggctattggca
cctgggaaggtgtctgaggatgacaagctggtggagtatgatgctctactgttggacagg
ttcctggatattcttcaggatttgcatggggagaatctcagagaaacggttcaagattgt
tatgagctttcagctgagtatgaagggaagcatagtccgcaaaagttggaggagcttggg
aatgtcctaacgagtttggatcctggggactcaattgttgttgctaaatcattttctcac
atgcttaatttggccaacttggcagaagaagttcaaattgcttaccggaggaggatcaag
ttaaagaagggagattttgctgatgagaactctgccactactgaatcagacattgaggag
actttcaagaggcttgtggggcaactgaagaagtcccctgaagaagtttttgatgctttg
aagaaccagacggtagatttggttctaactgcacatccgactcagtctgttcgaagatct
ttgctgcaaaagcatgcaaggataagggattgtttgactcagttgtatgccaaagacatt
actcctgatgataagcaggaacttgatgaggctttacaacgggagattcaagctgcattt
cgtacggatgaaatacgaaggacaccaccaactccacaagatgagatgagggctggaatg
agctacttccatgagacaatctggaaaggtgtaccaaaattcttgcgccgtgttgataca
gctttgaagaacctagggatcaatgaacgtgttccttacaatgctcctctcattcaattc
tcttcttggatgggtggcgatcgggatgggaacccccgggttactcctgaagttacaagg
gacgtatgcttactggctagaatgatggctgctaatttgtacttttcccagattgaggat
ctcatgtttgagttatcaatgtggcgttgcagtgatgaacttcgtgttcatgctgatgaa
cttcacaggtcctcaaagaaagatgcaaaacactacatagagttttggaagcaaattcct
ccaaatgagccatatcgtgttattcttggtgatgtaagagacaagctgtataacacacgt
gagcgtgctcgtcatttattagctaatgggatctctgatattcctgaagacacaacattc
actaacattgaacagttcctggagcctcttgaactctgttacaggtcactctgctcatgt
ggtgacaggccgattgctgatggtagccttcttgatttcttaagacaagtttctaccttt
gggctttcacttgtaaaacttgatatccggcaagaatcagacaggcacactgatgttatt
gatgctatcacaaagcacttgggcatcgggtcttataaagaatggtcagaggaacacagg
caagaatggctcttgtctgagctcagaggcaagcgtcctctttttgggcccgatcttccc
aaaactgatgaaattgctgatgtcttggacactttccatgtcatttcagaactttctcca
gacaactttggtgcctatataatctcaatggcaacagccccatcagatgtgcttgccgtt
gagcttttgcaacgagaatgtcatgtgaagaagcctttaagagttgtcccattgtttgaa
aagcttgctgatcttgaggctgctcctgctgctgtggctcgactcttctcaatagaatgg
tacagaaacaggatcaatgggaagcaagaagtcatgatagggtactcagattccggaaaa
gatgcaggccggctatctgctgcctggcaattatataaggctcaagaagagctaataaag
gtgtcaaagcaatatggggttaagcttacaatgtttcatggccgtggagggacagttggt
agaggaggaggacccacccatctcgctatactatctcagccacctgacaccattcatggt
tcacttcgtgtgacagttcaaggcgaagtcattgaacagtcatttggggaggagcacttg
tgctttagaacactgcaacgtttcacagctgctacacttgagcacggtatgcatccacct
gtctcaccaaagcccgaatggcgtgcactcatggatgagatggcagttattgcaacaaag
gaataccgctccatagttttccaggaacctcgttttgttgaatacttccgcctcgcaaca
ccagagttggaatatggtcggatgaacattggaagtcgtccatcaaaaaggaagccaagt
ggaggcattgaatctctccgtgcaattccttggatctttgcatggacccaaacaaggttt
catctaccagtgtggcttggatttggggcagcgtttaagaacataattgagaagaacata
aagaatcttcacatgcttcaggagatgtataatcagtggcctttcttcagggtcacaatt
gacctagttgagatggtgtttgctaagggagacccaggaattgcggctctgtatgacaag
ctcctagtgtcagaagaactgtggtcatttggagagcatttgagagccaatcatgaagaa
actaagcagcttctcctccagattgccgggcataaggatctactggaaggagacccatac
ttgaggcagagactccgtcttcgtgattcctacatcacaactcttaatgtctgccaagcc
tacacactgaaacgcatccgtgaccctgactaccatgtgaaggtgaggccccacttgtca
aaggaatacacagaatcaagcaagccagctgcagagcttgtgaagcttaacccaatgagc
gagtatgctccaggtttggaagatacccttattttaacaatgaaaggtattgctgctggg
atgcagaacaccggttag

DBGET integrated database retrieval system