KEGG   Juglans regia (English walnut): 108985586Help
Entry
108985586         CDS       T05245                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2-like
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00220  Arginine biosynthesis
jre00250  Alanine, aspartate and glutamate metabolism
jre00260  Glycine, serine and threonine metabolism
jre00630  Glyoxylate and dicarboxylate metabolism
jre00710  Carbon fixation in photosynthetic organisms
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
jre01210  2-Oxocarboxylic acid metabolism
jre01230  Biosynthesis of amino acids
Module
jre_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
jre_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108985586
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108985586
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108985586
   00260 Glycine, serine and threonine metabolism
    108985586
   00220 Arginine biosynthesis
    108985586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jre01007]
    108985586
Enzymes [BR:jre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     108985586
    2.6.1.4  glycine transaminase
     108985586
    2.6.1.44  alanine---glyoxylate transaminase
     108985586
Amino acid related enzymes [BR:jre01007]
 Aminotransferase (transaminase)
  Class I
   108985586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 108985586
NCBI-ProteinID: XP_018813477
UniProt: A0A2I4E254
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MSPKALDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLLFPADAIAKAKHYLSLTSGGLGAYSDSRGIPGIRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNTIIRGERDGVLVPVPQYPLYSAAISLFGGSLV
PYYLEETANWGLDINDLRQSVAAAHSKGITVRAMVIINPGNPTGQCLSEANLREILKFCY
QEDLVLLGDEVYQQNIYQDERPFISARKVLMEMGPPIRKELQLVSFHTVSKGYWGECGQR
GGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPPKPGDISYEQFVRESKGII
ESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAIEAAKRAGKVPDVFYCLKL
LEATGISTVPGSGFGQREGVFHLRTTILPAEEEMPAIMDSYKKFNDEFMEQYEDHRGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaaggcattagactacgagtcactgaatgaaaatgtgaagaaggtccaatat
gctgtaagaggcgaactgtatcttcgagcttctgagcttcagaaagaagggaaaaagatt
attttcacaaatgttggtaatcctcatgcactaggacagaagccactgacatttcctcgc
caggtggttgctctgtgccaagctccatttctactagatgacccaaatgttggtctgctt
tttcctgctgatgcaattgcaaaagcaaaacattatctttcattaacttcgggtggtctt
ggtgcctacagtgactcccgaggtattccaggaataaggaaggaagtggcagagttcatt
gaaaggcgtgatggttatccaagtgacccagagctcatatttctcacggatggtgctagc
aaaggtgtgatgcagatcttgaataccatcatccgcggtgaaagggatggggttttggtt
ccagtaccccagtaccctctttactcggctgcaatatctctattcggtggttctcttgtt
ccatattacctagaggagacagctaattggggcctcgacattaatgaccttcgccagtca
gttgctgcggctcactctaaaggaataactgtaagggcaatggtgattataaaccctgga
aaccccacaggtcagtgtcttagtgaagctaatttgagagaaatacttaagttctgctac
caagaagacttagtcttgcttggagatgaggtttatcagcagaacatataccaggatgaa
cgcccctttattagtgctagaaaggttttaatggaaatgggaccacccataaggaaggaa
ctccagcttgtctctttccacactgtgtccaaaggatattggggtgaatgtgggcagcgg
ggtggatactttgagatgactaacattcctccaaagacagttgatgagatctataaagtt
gcttccgtttcactcagcccaaatgtgcctgcacagatatttatggggctgatggtgaac
ccacccaaacctggagatatctcatatgagcaatttgttcgggaaagcaaaggaattatt
gaatcactaaggagaagagcaaggataatgactgatggatttaatagctgcagaaatgtg
gtttgtaattttacagaaggtgccatgtattcgttccctcaaatacgcttgccacaaaga
gcaatagaagctgccaaaagggccggaaaggttcctgatgttttctattgtctcaaactc
ttggaagccactggcatttcaactgtccctggctcaggatttggacagagagaaggggtc
ttccacttgaggacaaccatcttacctgctgaggaggaaatgcctgcaatcatggacagt
tacaagaaattcaatgatgagtttatggagcaatatgaagaccatagaggttattcgagg
atgtaa

DBGET integrated database retrieval system