KEGG   Juglans regia (English walnut): 108986075Help
Entry
108986075         CDS       T05245                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00061  Fatty acid biosynthesis
jre00780  Biotin metabolism
jre01100  Metabolic pathways
jre01212  Fatty acid metabolism
Module
jre_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108986075
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    108986075
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    108986075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:jre01004]
    108986075
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     108986075
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     108986075
Lipid biosynthesis proteins [BR:jre01004]
 Fatty acid synthase
  Component type
   108986075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 108986075
NCBI-ProteinID: XP_018814143
UniProt: A0A2I4E426
LinkDB All DBs
Position
Unknown
AA seq 202 aa AA seqDB search
IVFQEVAESVKKDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSYVSLLKHF
VPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTKVLAFEAGRKHKIRVNTISA
GTLVHNLPANILPVSYTGQSHGQSSYTTDDLPKTVVMTLNQGSAVKSMDFHPLQQILLLG
EPLLMYRMCNVSLLLVAIPVIG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
attgtctttcaggaagttgctgaatctgtgaagaaggattttggcagcatcgacatcctt
gttcactcacttgcaaatgggcctgaggtcagcaaacctctgttggagacatccaggaaa
ggatatcttgcagctatatctgcatcaagttactcctatgtttctttactgaagcatttt
gttccaataatgaatccaggtggttcttcaatttctcttacatatattgcttctgagagg
attatacctggatatggtggaggcatgagttctgcaaaagctgctctggaaagtgacaca
aaagtgcttgcttttgaagcgggcagaaaacataaaatcagagtcaacacaatatctgct
ggtaccttggtccacaacctgccagcaaatattctgcctgtttcatacactggacagagc
catggtcaaagttcctacactactgatgacttgcccaaaactgttgttatgactctaaat
caaggatcagctgtcaagagtatggatttccatccactgcagcagattctacttcttggt
gagccccttttaatgtacagaatgtgtaatgtgagtttactcttagtggcaatccctgtc
ataggctag

DBGET integrated database retrieval system