KEGG   Juglans regia (English walnut): 108986277Help
Entry
108986277         CDS       T05245                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    108986277
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108986277
Protein kinases [BR:jre01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   108986277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH FTA2 Pkinase_C RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 108986277
NCBI-ProteinID: XP_018814393
UniProt: A0A2I4E4T2
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MVSSQLPGFTKTRICKPLQTQLLFPVNPTDAAVTDHVELDFSDVFGPLPVQSSMETNCCD
SGNSISAEDANELIYDDPVVIYSRSHSLVGPSCISQSLKLSKLTIHESEDLVQLAECVEG
ETIKEVQKPAIEDGKIEKCFKDVDGNFMKVESVGIDDFEILKVVGQGAFAKVYQVRKKGS
LEIYAMKVMRKDKIVEKNHAEYMKAERDILTNVDHPFIVQLRYSFQTKYRLYLVLDFVNG
GHLFFQLYHHGLFREDLARLYAAEIVSAVSHLHANGIMHRDLKPENILLDADGHAMLTDF
GLAKKFDENTRSNSMCGTLEYMSPEIVLGKGHDKAADWWSVGVLLFEMLTGKPPFTGNRE
KIQQKIVKEKIKLPAFLTSDAHSLLKGLLQKEAGKRLGCGPTGSEEIKRHKWFKPINWKK
LETRQIQPSFRPEVAGKHCIANFEKRWTDMPVVDSPAASPNAGGNPFMGFSYVRPAAYFL
QKDSSSTTFH
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatctcaattacctggttttaccaagacccgcatttgcaaaccattgcaaacc
caattactttttcctgtgaaccccacagatgctgcagttacggatcatgttgaactggat
ttctctgatgtgtttggtcctctaccagttcagtcttcaatggaaacaaattgctgtgat
tctggtaactccatttctgcagaagatgcgaatgagctaatttatgatgatccggttgtc
atttacagccgatcacattctctagttggcccttcttgtatcagtcaatcgttgaagctc
agcaagctcaccattcatgagtcagaggatttggtgcaactagcggagtgtgtcgaagga
gaaacgattaaagaagttcagaaacctgccattgaggatggaaaaattgagaaatgtttt
aaagatgttgatggaaatttcatgaaggttgagagtgtaggcattgatgattttgagatc
ttgaaggttgttgggcagggtgcatttgcaaaagtatatcaggtgaggaaaaagggtagt
ttagaaatatatgcaatgaaggtcatgcggaaggacaagattgtggagaagaatcatgca
gaatacatgaaagctgagagggatattttgacaaatgtagatcatcccttcattgtccag
ctcagatactcattccaaacaaaatatagattatatcttgtgctggattttgtaaatggg
ggtcaccttttctttcagctctatcaccatggccttttcagggaagatcttgcccgctta
tatgctgctgagattgtatctgcggtttctcacctccatgcaaatggaataatgcacaga
gatcttaaacctgaaaatattctactggatgcagatggccatgcaatgttgactgatttt
ggactggcgaagaaatttgacgaaaatacgaggtctaactccatgtgtggaactctagaa
tacatgtcacctgaaattgttcttggaaaggggcatgataaggcagctgactggtggagc
gtgggagtcctattatttgagatgctaactggcaagcctccttttactgggaaccgagag
aaaattcagcaaaagatagtaaaggaaaagatcaagcttccagcgttcttgacaagtgat
gcacattctctgttaaaagggctgctacagaaagaagcaggcaagcgccttggttgtgga
cctactgggagcgaggaaattaagcgtcataagtggttcaagccaatcaattggaagaaa
ctggagacccgacaaatccagccaagttttcgtcctgaagttgccgggaagcactgcata
gctaactttgagaagcgctggacggacatgccagttgtggattcaccagctgctagtcca
aatgctggtggaaaccctttcatgggcttcagttatgtgaggcctgcagcttattttctt
cagaaggatagctcctccaccaccttccactag

DBGET integrated database retrieval system