KEGG   Juglans regia (English walnut): 108986754Help
Entry
108986754         CDS       T05245                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00010  Glycolysis / Gluconeogenesis
jre00020  Citrate cycle (TCA cycle)
jre00620  Pyruvate metabolism
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
Module
jre_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108986754
   00020 Citrate cycle (TCA cycle)
    108986754
   00620 Pyruvate metabolism
    108986754
Enzymes [BR:jre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     108986754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 108986754
NCBI-ProteinID: XP_018815040
UniProt: A0A2I4E6N0
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MASTPFLCRPSLSNTSISFSSSTSTSLPAHFLRSPSSKNYSRRRILSVRSKIREIFMPAL
SSTMTEGKIVSWIKSEGDRLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGESAPVG
APIGLLAETEEEIDEARAKAASKSAPSTPKAVTPTPPPPTSTPAPAISQPPPPPAKPASD
GPRKIVATPFAKKLAKQHKVNIESVVGTGPFGRVTPADVETAAGITPSKGIGTNAGSNIV
SQPTPPKPAPSVAAPPPVPGSTVVPFTTMQAAVSKNMVDSLAVPTFRVGYPVTTDALDAL
YVKVKPKGVTMTALLAKAAAMALVQHPVVNATCKDGKSFAHNSSINIAVAVAIDGGLITP
VLQDADKLDLYLLSEKWKELLKKARAKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQ
GAIMAVGASKPTVVADADGFFSVKSKMLVNVTADHRIIYGADLAAFLRTFAKIVENPESL
TL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcttccacccctttcctctgcaggccctctctctccaacacctccatttccttctct
tcctccacctccacctccctccccgcgcattttctacgctccccctcgtccaagaattat
tcccggcggaggattctctccgtccgatccaagatcagggagatcttcatgccggccctc
agctccaccatgaccgagggcaagatcgtctcctggattaagtctgagggcgaccgcctc
tccaagggcgaaagcgtcgtcgttgtcgagtccgacaaggccgacatggatgtcgagacc
ttctacgatggtatcctcgccgccatcgtcgtacccgagggtgagtctgcccctgtcggc
gctcccatcggcctcttggccgagaccgaggaagaaatcgatgaggccagagccaaagcc
gcctccaaatccgctccttctactcccaaagccgttactcccactcctccacctcctact
tccactccagctcctgcaatttctcagcctccgcctccgccggctaagccagcctctgac
ggcccgaggaaaatcgtagcaaccccgtttgcgaagaagttagctaagcagcacaaggtc
aatatcgaatcggtagtggggaccgggccattcggtcgagtcacaccagccgatgtggag
accgcagcgggaatcacgccttcgaagggtattggaaccaatgccggttcgaacattgtc
tcccagccgacgccaccaaaacccgccccctctgtggctgctccacctccggttcctggc
tccacggtcgtgcccttcacgacaatgcaagcggcagtgtcgaagaacatggtggatagc
ctcgccgtgcccactttccgcgtcggttatccagtgacaaccgatgctctcgatgcgctg
tatgtgaaggtgaaaccaaaaggtgtgaccatgactgcgctgttagccaaggctgcagcg
atggcgctggttcagcacccggttgtcaatgcgacctgtaaagatggaaagagctttgcg
cacaatagtagcataaacattgctgttgctgtggctatcgatggtgggttgataacccct
gttcttcaagacgcagataagttggatttgtatctgttatcggaaaaatggaaagagcta
ctgaagaaggctcgggcgaagcaacttcagcctaatgagtataattcagggactttcact
ttatccaatctgggcatgtttggagtggacagatttgatgctattcttcctccaggccag
ggggctatcatggctgttggagcatcgaagcctaccgttgtggctgatgcagatggattt
ttcagtgtaaaaagtaaaatgctggtgaatgtaacagcggatcaccggattatttacggt
gctgacttagctgcctttcttcggacgttcgcaaagattgttgagaacccagaaagcctg
acattgtag

DBGET integrated database retrieval system