KEGG   Juglans regia (English walnut): 108987298Help
Entry
108987298         CDS       T05245                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00071  Fatty acid degradation
jre00592  alpha-Linolenic acid metabolism
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01212  Fatty acid metabolism
Module
jre_M00087  beta-Oxidation
jre_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108987298
   00592 alpha-Linolenic acid metabolism
    108987298
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     108987298
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     108987298
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     108987298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 108987298
NCBI-ProteinID: XP_018815731
UniProt: A0A2I4E8K7
LinkDB All DBs
Position
Unknown
AA seq 726 aa AA seqDB search
MGSGAKGRTVMEVGADGVALITLINPPVNSLSFDVLRSLKDCYEEALRRDDVKAIVVTGA
KGKFSGGFDIGAFEGFRNGSMGRETKPGYISIEIITDTVEAARKPSVAAIDGLALGGGLE
VAMACHARISTPAAQLGLPELQLGLIPGFGGTQRLPRLVGLSKALEMMLMSKPVKGEEAH
TLGLVDAIVSRDELVNIARQWALDIFHRRRPWVASLYKTDKIEPLGEAREILKFARAQAR
KQAPNLKHPLVCIDAIEEGIVSGPRAGLWKEAEAFQALPHSDTSKSLVHIFFAQRGTSKV
PGITDIGLVPRQVNKVAILGGGLMGSGIATALILSNYPVILKEVNDKFLQAGIGRVRANL
QSRVKKGKMSQEKFEKTISLLKGALDYESFKDVDMVIEAVIENVSLKQQIFADLEKYCPP
HCILASNTSTIDLNLIGEKTRSQNRIVGAHFFSPAHVMPLLEIVRTKQTSPQVIVDLLDV
GKKIKKTPVVVGNCTGFAVNRMFFPYSQAAILLVEHGTDPYQIDRASTKFGMPMGPFRLA
DLVGFGVAIATGMQYIEHFPERTYKSMLIPLMQEDKRSGQSTRKGFYIYDEKRKASPDPE
LYKYIEKSRSISGVTIDPKLVKLPEKDIVEMIFLPVVNEACRVLAEGIAVKAADLDIAAV
MGMGFPPYRGGIMFWADSLGSKYIYSRLEEWSRLYGEFFKPCAYLAERAAKGAPLSAPAE
QAKSRL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcggtgcaaagggaagaacggtcatggaggtgggagccgatggggtggctctc
ataaccctaatcaaccctcctgttaattccctctcctttgatgtgttgcgcagcttaaag
gactgttatgaggaggccttaagaagagacgatgtgaaggccatcgttgtaaccggcgca
aagggcaagttttctggtggctttgatattggagcttttgaaggatttcgaaatggatca
atggggagagaaacgaaacctggctatatatctatagagattattaccgacacggtagaa
gctgcaagaaagccttcagttgctgccatcgatggccttgctttaggtggaggattagag
gttgcaatggcatgccatgctagaatatcgactcccgctgctcaattagggttgcctgaa
cttcagcttggattaattcctggatttggaggaacacaacggcttccacgtcttgttggt
ctctcaaaagcacttgaaatgatgctgatgtcaaagccagtcaaaggagaggaggcccat
actttgggccttgtggatgcaattgtttcacgtgatgagttggtaaatattgcacgtcag
tgggctctggatatctttcaccgtagaagaccatgggttgctagtctttacaagaccgac
aagatagagccccttggagaagcgagggaaatactgaaatttgcaagagctcaggcccgg
aagcaggctcccaatctcaaacacccattggtttgcattgatgccattgaagagggtata
gtatctggtccccgggctggactctggaaggaggctgaagcttttcaagcacttccacat
tctgacacttccaagagtttggtgcatatcttctttgctcaacgtggaacgtcaaaggta
ccggggattactgatattggtttagtgccaagacaagttaataaggtcgctattcttggt
ggaggactaatgggctctggaatagcaacagcattgattcttagtaattatccagtcatc
cttaaagaagtaaacgacaagttcttgcaggctgggattggtagagtgagagccaatttg
caaagccgagtgaagaaagggaaaatgtctcaagagaagtttgagaaaaccatatctctt
ctcaaaggtgcccttgactatgaaagctttaaagatgtggacatggtgattgaggctgta
attgagaatgtttctttaaagcaacaaatttttgctgatcttgagaagtattgcccacca
cattgcatacttgccagtaacacctccacaattgacttgaacctgattggagaaaagaca
agatcccaaaatcggattgtgggagctcatttctttagtccggctcatgtcatgccactt
ctagaaattgttcgtactaagcagacatctccccaagtaattgttgacttgctagatgtt
ggtaaaaaaattaagaagactccagtggtggttggaaactgcacaggctttgctgtcaac
aggatgttcttcccttattcacaagctgctattttgcttgttgagcatggtacagatccc
tatcagatcgatagggcaagtaccaagtttggaatgccaatgggacctttcagattagct
gacctggttggttttggtgttgcaattgcaactggcatgcaatatatcgagcattttcct
gagagaacttataaatcgatgcttataccacttatgcaagaggataagagatcaggtcag
tctactcgcaaagggttctatatatatgatgagaagcgcaaagctagcccagatcctgaa
ttatataaatatattgagaagtcaaggagcatttctggtgtaaccattgaccctaagcta
gtgaagttaccagaaaaggatattgtggagatgatattcttaccagtggtaaatgaggcc
tgccgagtccttgccgagggtattgcagtcaaagcagcggaccttgacatcgctgctgtc
atgggcatgggtttcccaccttacagggggggtattatgttctgggctgattctcttgga
tctaaatacatctattcgagattggaggaatggtcaaggttgtatggagaattcttcaag
ccttgtgcctatttggctgaaagagctgccaagggggctcctctgagtgctccggcggag
caagcaaaatctcggttgtag

DBGET integrated database retrieval system