KEGG   Juglans regia (English walnut): 108988120Help
Entry
108988120         CDS       T05245                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
jre  Juglans regia (English walnut)
Pathway
jre03030  DNA replication
jre03410  Base excision repair
jre03420  Nucleotide excision repair
jre03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108988120
   03410 Base excision repair
    108988120
   03420 Nucleotide excision repair
    108988120
   03430 Mismatch repair
    108988120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:jre03032]
    108988120
   03400 DNA repair and recombination proteins [BR:jre03400]
    108988120
Enzymes [BR:jre01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108988120
    6.5.1.6  DNA ligase (ATP or NAD+)
     108988120
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108988120
DNA replication proteins [BR:jre03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108988120
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108988120
DNA repair and recombination proteins [BR:jre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108988120
   NER (nucleotide excision repair)
    Other NER factors
     108988120
   MMR (mismatch excision repair)
    Other MMR factors
     108988120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 108988120
NCBI-ProteinID: XP_018816789
UniProt: A0A2I4EBL9
LinkDB All DBs
Position
Unknown
AA seq 1442 aa AA seqDB search
MASQSSETLALDSSHLFLTALQSLRQQQEPPLPLSLASVPTSFPRSKLIPKTRFAIDAFR
FAGDFSVSYFLSHFHSDHYTGLSPNWSRGVVFCSHTTARLLVEVLKVPSPFVIPLPLRET
VAIDGSEVTLVDANHCPGAVQFLFRIPGPNGKFERFVHTGDFRFCDSMKLEPLFSEFTGS
DAVFLDTTYCNPKFVFPSQDESVEYVASVIERIGGAYDKDGLMKNVLFLVATYVIGKEKI
LLEIARRCDRKIYVDARKMEILRVLGYGDSGVFTEDERESDVHVVGWNVLGETWPYFRPN
FVKMKEIMEERGYSKVVGFVPTGWTYEVKRNKFTVRSKDSFDIHLVPYSEHSNYDELRNY
VKLLKPKRVVPTVGLDVENLESKHANKMRKHFAGFVDEMANKKEFLRGFYRGSFEMVEKD
ASGASNECLDRDNEAETSVSKVIKTGYPGFVLESSLSLKEPATQDPVLLNDEDASPLQQP
CSQDLSMLNDDETEKIIQELCDCLPAWVTRSQILDLISSSGRDIVEAASNFYERETEFHK
QVLASKASESSQKSLLNDSTSVSNPGFVTSNPVGSVDKFLSQFDKSVNLIDSIKSNISPG
KRKRTIEAEPNKKVKVNSIKNGTSPGKTKTKTENKPDKKVKINTKSYSGGSKQPTITRFF
SKVLPDVSQGGKVGTLLEESPKDENLVPDDDAKLYRDEIAQFIQIISGNESSNGYAATIL
NKTKGDVNKALDIYYCDTQGGLGDSVKSVLEQSNMDNYSPGQKKNASGKSEHTPDISVQA
LLTKDLDATLVALPSEKYDPIKHACWRSGQPAPYIHLARTFDLLEDEKGKIKATSMLCNM
FRSLLTLSPEDVLPAVYLCTNKIAANHENIELNIGGSLVTSALEEACGTNRCKIREMYNK
LGDLGDVAQECRQTQTLLVTPSPLLIRDVFSALRKISVQTGNGSTVRKKNLIVNLMCTCR
EKEMKFLVRTLIRNLRIGAMIRTVLPALAQAVVFNSSPGFYPEGRVDNLKDRLQCLSVAV
VEAYNILPNLDLVVPSLMNKGIEFSSSTLSMVPGIPIKPMLAKITNGIPQALKLFEHKAF
TCEYKYDGQRGQIHRLVDGSFHIFSRNGDETTSRFPDLINIIKESCKPSAVTFVLDAEVV
AVDRKNGCRLMSFQELSSRGRGSKDTFITVNSIKVDICVFVFDIMFANGERLLGFPLRQR
RKKLKELFCDEKLGYFEYAKEMTVEANDACMTNEATLSKINSFLEDAFRSSCEGIIVKSL
DVDAEYSPSKRTDTWLKVKRDYVEGLCDSLDLVPIGAWHGNGRKAGWYSPFLVACYNPDT
EEFQSVCRVMSGFADSFYREMKDFFSGDTILSKKPPYYLTAEVPDMWFLPELVWQIRGAD
FTLSPVHKAAIGLVHPSRGISIRFPRFICPVSDRNPEECSTAADVAEMFQSQTRRMDVAA
ED
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccaatcctccgaaaccctagcactggactcctcccatctcttcctcactgcc
cttcaatccctccgccaacaacaagaaccaccactccctctctctcttgcttccgttccc
acctcttttccccggtccaaactcatccccaaaacccgtttcgcgatcgatgccttccgt
ttcgccggtgatttctccgtttcctacttcctttcccacttccactccgaccactacacc
ggcctctcccccaattggtccagaggcgtcgttttctgctcccacactaccgctcgtctc
ctcgttgaagttctcaaagtcccttcgccgttcgtcattccattaccgcttcgcgaaact
gttgcaatcgacggcagtgaggttacacttgtcgacgcgaatcattgtcccggtgcggtg
caatttctgttcaggattccaggtcccaacggcaaattcgagaggtttgttcacacgggc
gatttccggttttgcgattccatgaaattagagcctcttttctctgaatttaccggatcg
gatgcggttttcttggatactacgtattgtaatccgaaatttgtgtttccgtcacaagat
gagtctgtcgagtatgttgcaagtgtcatagagagaataggaggtgcgtatgacaaggat
ggcctaatgaaaaacgttttgtttcttgtagctacttatgttattgggaaagagaagatt
ttgcttgaaattgctcggaggtgtgacaggaagatatatgtggacgctagaaaaatggag
attctgcgtgtcttggggtacggtgatagtggggtgtttacagaggatgagcgtgaaagt
gatgttcatgttgttgggtggaatgtattgggtgagacatggccttattttaggccgaat
tttgtgaaaatgaaggagatcatggaggaaagagggtactcgaaggttgtgggttttgtt
ccgacagggtggacatatgaagtgaagcgcaataaatttacggtgaggtctaaggattct
tttgatattcatcttgtaccgtatagtgaacattcaaactatgatgaacttaggaattat
gtgaagctgttgaaaccgaagcgtgttgttcctacagtggggttggatgttgaaaacctt
gagagtaagcatgctaataaaatgcgaaagcattttgctgggtttgttgatgaaatggcc
aacaagaaagagttcttgaggggcttttatcgaggctcttttgagatggttgaaaaggat
gccagtggtgcctcaaatgagtgtctggaccgggataacgaggccgagacatctgtgtca
aaagtcattaaaactggttatccgggttttgtgttggaatcgtcattgtctctgaaagaa
ccggctacacaagatccagtcttattgaatgatgaggatgcatctcctctccaacaacct
tgttcacaagatctatccatgttaaatgacgatgaaacagagaaaatcattcaggaactt
tgtgattgtttgccagcatgggtcactagaagccaaatcttagatctgattagcagctct
ggaagggatattgttgaggcggcctccaatttctatgagcgtgaaactgaatttcacaag
caagtattagctagtaaagcttctgagtcttctcagaaaagcttacttaatgactccacc
tcggtttcaaacccaggctttgttacgagcaatcctgttggaagtgtggacaaattttta
agtcaatttgataagtctgtcaacctgatagattcaatcaagagtaacatttcccctgga
aaaaggaaaaggactattgaggctgagccaaacaagaaggtaaaagtcaattcaattaaa
aatggcacttctcctggaaaaacgaaaacaaagaccgagaataagccggacaagaaagta
aagatcaatacaaagtcgtactctggtggatcaaaacaacctacaataacaaggtttttc
agtaaagttttgcctgatgtttcccaaggtggtaaggttggaaccttgttggaggaaagc
cctaaagatgaaaatctggtgcctgatgatgatgcgaaattatacagggatgaaatagct
cagtttattcaaataataagcggtaacgaatcatctaatggctatgctgctaccatccta
aataaaacaaaaggagatgttaacaaggcactggatatatactactgtgatactcagggt
ggccttggtgactctgttaaatcagttctggagcagagcaatatggacaactactctcct
ggccaaaaaaagaatgcgtcagggaaatcagaacatactcccgatatctctgtgcaggca
ttgttaacaaaggatctggatgcaactcttgtagcactaccgtcagaaaaatacgatcct
ataaagcatgcatgctggagaagtgggcaacctgctccatatatacatcttgcgagaaca
tttgacctgcttgaggatgagaaaggaaagataaaagctacttctatgttgtgcaatatg
ttcagaagtctgctgaccttgtctcctgaggatgtgttgcccgccgtatatttgtgcaca
aataagattgctgctaaccatgaaaatatagaactaaatatcggtggaagtttggtcaca
tcagcattggaagaggcatgtggcacaaaccggtgcaaaataagggagatgtataacaag
ctcggtgatcttggtgatgttgctcaagaatgccgacaaacacagactttacttgtcact
ccttcaccacttctaattagagatgtattttctgcactccgaaagataagtgtacaaaca
ggcaatggaagtactgttcgaaagaaaaaccttattgtaaatctcatgtgtacttgtaga
gagaaggagatgaagtttcttgttagaactttgataaggaatttacggattggagcaatg
atccgaactgttcttcctgctttggctcaagcagttgtttttaattcctcccctggcttt
taccctgaaggaagagttgataatttgaaggacaggcttcagtgcctttctgtggcagtg
gttgaagcctataatatcctccccaatttggatctggttgttccttctctcatgaacaaa
ggcatcgaattctcttcttcaacgttgtctatggttccaggaattcctattaagcctatg
cttgcaaaaatcacaaatggtattccgcaagcactgaagctcttcgaacataaagctttt
acatgtgaatataagtatgacggtcagcgtggccaaattcacagattagttgatggatct
tttcatattttttctcgaaatggagatgaaacaacatcaagatttccggatttgattaat
ataattaaagagtcgtgtaaaccttctgcagtgacttttgtactggatgcagaggttgtt
gcagttgatagaaagaatggctgcagactcatgtccttccaagaactatcttcacgaggg
agagggagcaaagatacctttatcacagtgaatagcataaaggttgacatttgcgtgttt
gtattcgatataatgtttgctaatggagaacggcttttgggttttcctctccgccaaaga
cgaaaaaaattgaaggaattgttttgtgatgagaagttgggatattttgaatatgcaaag
gaaatgacggttgaagcaaatgatgcttgtatgactaatgaagccacattaagcaagata
aattcttttcttgaagatgcgttccgctcctcatgtgaagggatcattgtgaaatcatta
gatgttgatgctgaatattctccctcaaagcgtactgacacatggttaaaggtcaagcgt
gactatgtggaaggattatgtgactctcttgatttagtcccaatcggtgcttggcatgga
aatgggagaaaagctggatggtacagtccatttcttgtggcatgttacaaccctgacact
gaggaattccaaagcgtgtgccgtgtcatgtctgggtttgcagattctttttacagagag
atgaaagatttcttttctggggacacgattttatccaaaaagccaccatattatctaaca
gctgaggtgcctgatatgtggtttttgccagaacttgtttggcaaataagaggtgcagac
ttcacactgtcaccagttcacaaggcggccataggtttagttcatccatctcgaggtatc
tcaatcagattccccagattcatctgccccgtttctgatagaaatccagaagaatgtagc
acagctgcagatgtagctgaaatgtttcagtctcagactcgaaggatggatgtggcagct
gaagattga

DBGET integrated database retrieval system