KEGG   Juglans regia (English walnut): 108988130Help
Entry
108988130         CDS       T05245                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00250  Alanine, aspartate and glutamate metabolism
jre00410  beta-Alanine metabolism
jre00430  Taurine and hypotaurine metabolism
jre00650  Butanoate metabolism
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108988130
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108988130
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108988130
   00430 Taurine and hypotaurine metabolism
    108988130
Enzymes [BR:jre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108988130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 108988130
NCBI-ProteinID: XP_018816807
UniProt: A0A2I4EBN5
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MVLSKAASESDVSVHSTFASRYVRTSLPRFKMSENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNRRKAEGKPWDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREDYFVMDPAKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLNPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNIMENCRENMLVLKDGLEK
TGRFNIVSKDDGVPLVAFSLKDNRRHDEFEVSDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVCDIKKVLHELDTLPAKITAKLAINGEEADKNVTLVTKKSDLETQRE
ITTVWRKFVMEKKKMNGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaagctgcatcagagtcggacgtctccgtccactccacctttgcctct
cgatatgttcgaacctcgcttcctagattcaaaatgtcggagaactcgatcccaaaggaa
gcggcgtaccagatcatcaacgacgagctcatgctggatgggaatccgaggctgaacctc
gcgtcgttcgtgaccacgtggatggagccggagtgcgataagctcatcatggcttccgtc
aacaagaactacgtcgacatggatgagtaccccgtcaccaccgagcttcagaatcggtgt
gttaacatgatagcgcatctctttaatgcaccactcggagaatctgaggccgcagttgga
gtggggacagtggggtcgtcggaggccataatgttggccggtttagcattcaagagaaag
tggcagaaccggaggaaagcagaggggaaaccctgggacaaacccaacattgttactgga
gccaatgttcaggtatgctgggaaaaattcgcaagatactttgaggtggaattgaaggag
gtaaagctgagggaggactactttgtgatggaccctgcgaaggctgttgagatggtagat
gagaacactatttgtgtcgctgccattctcggttccactctcaacggagagttcgaagat
gtcaagctcttaaatgatctactggttgagaagaacaaggaaactgggtgggatactccg
atccatgtcgatgcagcgagcggtggattcattgccccatttctaaacccagaactagag
tgggatttccgcttgccgttggtgaagagcatcaatgttagtggccacaagtatggactc
gtgtatgccgggattgggtgggttatctggaggagcaaagaggatttgcctgaagaactc
atcttccatatcaactatcttggagctgaccaacccaccttcaccctcaacttctccaaa
ggttctagtcaagtcattgctcaatactatcaactaattcgcttgggttttgagggatac
aggaatattatggaaaactgtagagaaaacatgctggtactcaaagacgggttggagaag
acagggcgctttaacattgtttcaaaagacgatggcgtgccattagtggccttttcctta
aaagacaacagacgtcatgatgagtttgaggtgtctgacatgttgcgacgctttggctgg
attgtgcctgcttacaccatgccgcccgacgcccaacacgtgacggtactccgagttgtc
atcagggaagacttttcgcgcactcttgcagagcgcctggtttgcgacatcaagaaagtt
ctgcatgaactcgatactcttccggcaaagatcactgccaagttagcaattaatggtgaa
gaggccgacaagaatgtcacactggttacaaagaagagtgatctcgagacgcagagggag
atcactacggtttggaggaagtttgtcatggagaagaagaagatgaatggcgtttgctag

DBGET integrated database retrieval system