KEGG   Juglans regia (English walnut): 108994493Help
Entry
108994493         CDS       T05245                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00061  Fatty acid biosynthesis
jre00780  Biotin metabolism
jre01100  Metabolic pathways
jre01212  Fatty acid metabolism
Module
jre_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108994493
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    108994493
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    108994493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:jre01004]
    108994493
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     108994493
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     108994493
Lipid biosynthesis proteins [BR:jre01004]
 Fatty acid synthase
  Component type
   108994493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 108994493
NCBI-ProteinID: XP_018825271
UniProt: A0A2I4F0U9
LinkDB All DBs
Position
Unknown
AA seq 391 aa AA seqDB search
MATAASGLQIAAVRPSFSSSRRLFKAGAAILGDNCKAASWNKLTSACHISSVIPFQRSFT
SSSIKFDKFFTKAMSEASDNKPASGLPIDLRGKRAFIAGVADDNGYGWAIAKSLAAAGAE
ILVGTWVPALNIFESSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDNLEDVPEDVKANK
RYAGSSNWTVEEVAESVKKDFGSIDILVHSLANGPEVTKPLLETSRKGYLAALSASSYSY
VSLLKHFVPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHKI
RVNTISAGPLRSRAAKAIGFIDMMIDYSLANAPLQKELSAEEVGNTAAFLASPLASAITG
AVIYVDNGLNAMGVGVDSPIFEELDIPKDKH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagcggcttctggcctgcaaattgcagcagtgagaccctccttttcttcttct
cgtagacttttcaaggcaggtgctgcaattcttggtgataattgcaaggcagcatcatgg
aataagcttacaagtgcatgccatatatcatctgtaatacctttccagcggagttttaca
tcatcctccattaaatttgataagttttttactaaagcaatgtctgaagctagtgataac
aagccagcctcaggtttgcctattgatttgagaggtaagagggcatttattgctggtgta
gctgacgacaatggatatggttgggcaatagcaaaatctcttgcagctgcgggtgctgaa
attctggtgggcacatgggtgcctgctttgaacatttttgaatccagcctgcgacgtgga
aagtttgacgagtcacgtgtgttgccagatggctctttgatggagattactaaagtatat
cccttagatgcagtcttcgacaaccttgaggatgtacctgaagatgtaaaagcaaacaaa
cgttatgcaggatctagtaattggactgttgaggaagttgctgaatctgtgaagaaggat
tttggcagcatcgacatacttgttcactcacttgcaaatgggccagaggtcactaagcct
ctgttggagacatcaaggaaaggatatcttgcagctttatctgcatcaagttactcctat
gtttctttgctgaagcatttcgttccaataatgaatccagggggttcttctatttctctt
acatatattgcttctgagaggattattcctggatatggtggaggcatgagttctgcaaaa
gctgctctggaaagtgacacaagagtgcttgcttttgaagcgggcagaaaacacaaaatc
agagtcaacacaatatctgctggtccactaaggagccgtgcggcaaaagcaattggattt
attgatatgatgattgactattcactagctaacgcacctctgcaaaaggaactatctgca
gaggaagtggggaacacagctgccttcctagcatcacctttggcatctgctatcaccggt
gctgtcatatatgttgacaatggcctgaacgcaatgggtgtgggagtggacagtccaata
tttgaggaacttgacattccaaaagataagcactag

DBGET integrated database retrieval system