KEGG   Juglans regia (English walnut): 108994555Help
Entry
108994555         CDS       T05245                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00010  Glycolysis / Gluconeogenesis
jre00020  Citrate cycle (TCA cycle)
jre00620  Pyruvate metabolism
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
Module
jre_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108994555
   00020 Citrate cycle (TCA cycle)
    108994555
   00620 Pyruvate metabolism
    108994555
Enzymes [BR:jre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     108994555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 108994555
NCBI-ProteinID: XP_018825347
UniProt: A0A2I4F124
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MASSSSFLSRPPLSKASISFSSSLSSGSLPQLFLPSSSSYSPFPSNNSARRILTVRSKIR
EIFMPALSSTMTEGKIVSWVKSEGDRLSKGESVVVVESDKADMDVETFYDGILAAIVVPE
GESAPVGAPIGLLAETEEEIAEARAKAASKSPPSTPKAVTPSPPPPISSPAPAIAQPPPS
PAKPVSDGPMKIVATPFAKKLAKQHKVDIDSVVGTGPFGRITPADVEAAAGITPSKSIGT
NAGSKIAEPVPSKPASPVTTPPPIPGSTVVPFTTMQAAVSKNMVDSLSVPTFRVGYPVTT
DALDALYEKVKPKGVTMTALLAKAAAMALVQHPVVNATCKEGKSFAYNSRINIAVAVAID
GGLITPVLQDADKLDLYLLSEKWKELLKKTRAKQLQPNEYNSGTFTLSNLGMFGVDRFDA
ILPPGQGAIMAVGASKPTVVADADGFFSVKSKMLVNVTADHRIVYGADLAAFLRTFAKIV
ENPESLTL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctcctcctccttcctctctcggcctcctctctccaaggcctccatttccttc
tcctcctctctctcctctggctccctcccacagttgtttctaccctcctcctcctcctac
tcgccctttccctccaataattctgcgcggaggattctcactgtccgttccaagatcagg
gaaatcttcatgccggccctcagctctactatgacggagggcaagatcgtctcctgggtc
aagtccgagggcgaccggctctccaagggcgagagcgtcgtcgtcgtcgagtccgacaag
gctgacatggacgtggagaccttctatgacggaatcctcgccgccatcgtcgtccccgag
ggtgagtccgcccccgtcggtgcccccatcggcctgttggccgaaaccgaggaagaaatt
gctgaagcaagagccaaagccgcctccaagtcccctccttctactcccaaagccgttact
cccagccccccgcctcccatttccagtccagctcctgcaattgctcagcctccgccttcg
ccagctaagccagtctcggacggcccgatgaagatcgtagcaacgccgtttgcgaagaag
ctggctaagcagcacaaggtcgacatcgactcggtggtggggactgggccgttcggccga
atcacaccggctgatgtggaggccgctgcgggaattacgccttcgaagagtattggaacc
aatgcaggttcgaaaatcgccgagcctgttccatcgaaacccgcctcgcctgtgaccact
ccgcctccgattcccggctctacggtcgtgcccttcacgacgatgcaagcggcagtgtcg
aagaacatggtggacagcctctccgtaccaactttccgcgtcggttatccagtgacgacc
gatgctctcgatgctctatatgagaaggtgaaaccaaaaggtgtgaccatgactgcgctg
ttggccaaggctgcagcaatggcactggttcagcacccagttgtcaatgcgacctgtaaa
gaaggaaagagttttgcgtacaatagtcgcataaacattgcggttgctgtggctatcgat
ggtgggttgataacccctgttcttcaggacgcagataagttggatttgtatctgttatct
gaaaaatggaaagagctgctgaagaagaccagagcgaagcaacttcagcctaatgagtat
aattcagggactttcactttatcgaatttgggcatgtttggagtggacaggtttgatgct
attcttcctccaggccagggggctatcatggctgttggagcatcgaagccaactgtcgtg
gccgatgcagatggatttttcagcgtaaaaagtaaaatgctggtgaatgtaacggctgat
caccggattgtttatggagctgatttggctgcctttcttcggacatttgcaaagattgtt
gagaacccagaaagcctgacattgtag

DBGET integrated database retrieval system