KEGG   Juglans regia (English walnut): 108996949Help
Entry
108996949         CDS       T05245                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00052  Galactose metabolism
jre00500  Starch and sucrose metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108996949
   00500 Starch and sucrose metabolism
    108996949
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108996949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 108996949
NCBI-ProteinID: XP_018828549
UniProt: A0A2I4FA71
LinkDB All DBs
Position
Unknown
AA seq 923 aa AA seqDB search
MMGDNNIRKQRSYPQLLPLQNHMTLLFFLFCSSIFFLCFLAPPLSAEKEKKTPLGYGYTV
RSVTVDPSGKSLNAHLDLIKSSSVFGPDIKNLNFIASFETGDRIRIKITDSDHHRWEIPQ
TIIPRETHFPHRLLPENHTPKRSSPSKTRFVLSDPTSDLIFTLYNTTPFGFSVFRRSSGD
AIFDASPTADSSTFLVFKDQYIQLSSSLPKARSSLYGLGEHTKSSFKLQASNEAQTLTLW
NADIASANLDLNLYGSHPFYMDVRSPSEDGRVAAGTTHGVLLLNSNGMDVEYSGDRITYK
MIGGIIDLYIFSGPSPVMVMEQYTELIGRPTPMPYWSFGFHQCRYGYKNISDIESVVAGY
AKAHIPLEVMWTDIDYMDGYKDFTLDPINFPVEKMKNFVDTLHQNGQKYVLIIDPGISVN
KTYGTYIRGMQADVFIKRDGVPYLGEVWPGPVYFPDFLNPASEVFWGGEIKNFRDILPVD
GLWLDMNEISNFITSLPTPNSTLDDPPYKINNAGVRRPINYNTVPATSLHFGNVTEYNVH
NLYGLLECKTTNAALINVTGKRPFILSRSSFVSSGKYAAHWTGDNAATWNDLAYTIPSIL
NSGIFGIPMVGADICGFSRNTTEELCRRWIQLGAFYPFARDHSEKYSIRQELYLWESVAA
TARKVLGLRYRLLPYFYTLMYEAHQRGTPIARPIFFSFPQDINTYEISTQFLIGEGVMVS
PALKSEAISVDAYFPAGNWFDLFNYSHSLSVHSGRYIRLDAPPDHINVHVREGNILAMQG
AAMTTRIARKTPFQLLVVVGSTGITTGEVFLDDGEEVVMGGKGGIWSLVRFFGGIVGNKV
SVSSEVVNGGYALSQKWIIDKVTFIGLEKGNRLKGTKLKGTKLNGKPVGKTNLDSHGQFL
VVEVSKLSLLIGKEFKLELEFLK
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggacaacaatataagaaaacagaggtcttatccacagcttctccctcttcaa
aaccacatgaccctgcttttcttcctcttctgcagcagcatcttcttcctctgtttcttg
gctccaccgctcagcgcagaaaaggaaaagaaaacgccacttgggtacggctacacggtt
cgatcggtgaccgttgatccctctggcaagtccttgaatgctcaccttgacctcatcaag
agctcctccgtctttgggcccgacattaagaatctcaatttcatcgccagctttgagacc
ggagatcggatccgaattaaaataaccgactccgaccaccatagatgggagatccctcaa
accataatcccccgcgaaacccactttccacaccgcctcctccccgaaaaccataccccg
aagaggtcctcaccgtcgaaaacccgcttcgtcctctccgacccaacctccgatctcatc
ttcactctctacaacaccaccccgttcggcttctccgtttttcggagatcatccggcgac
gccatcttcgacgcctccccaacggcagactcttccaccttcctcgttttcaaggaccag
tacattcagctctcttcctcgctccccaaagcaaggtcctctctctatggcctgggcgag
cacaccaagagctccttcaagcttcaggcctccaacgaggcgcagacgctcactctgtgg
aacgccgacattgccagcgccaatctcgacctcaatctttacggttcccacccgttctac
atggacgtcaggtcgccgtccgaagatggcagagtggcggctgggacaactcatggagtc
ctgcttcttaacagcaatggcatggatgtggagtacagtggggatcggatcacgtacaag
atgattggtgggattattgacttgtacattttttctgggccgtcgccggtgatggtgatg
gagcagtacacggagctcatcggccggcctacacccatgccgtattggtcttttggattt
catcaatgtcgatatggttacaagaatatttccgatattgaaagcgtggttgctggctat
gcaaaagctcatatacctcttgaagttatgtggacagatattgattacatggatgggtac
aaggattttacccttgatcccattaactttccggtagagaaaatgaaaaattttgttgat
actcttcatcaaaatggtcagaaatatgtgcttatcatagatcctggtatcagtgtgaat
aagacatatggtacctacattcgaggaatgcaagctgatgtcttcataaaacgtgatggt
gtcccgtacttgggtgaagtttggcctggcccagtctatttccctgactttttaaatcca
gccagtgaagtattttggggtggcgagataaaaaattttcgagatattcttcctgttgat
ggtctttggcttgacatgaatgagatttccaactttataacttctcttcccactccaaat
tctactctcgatgatcctccctacaaaattaacaatgctggagttcgccggcccattaat
tataacactgtacctgcaacatccttacactttggtaatgttaccgagtataatgtccat
aacctatatggactcttagagtgcaaaaccactaatgcagccttgatcaatgtgactggg
aaaaggccctttatactttctaggtcgagttttgttagctctggcaagtatgcagcacac
tggactggagacaatgctgccacgtggaatgatttggcatacacaattccatcaattttg
aactctgggatttttggaattccaatggttggtgcagacatctgtggtttttctagaaat
acaactgaagaactctgcaggcgctggattcagctaggagctttttatccctttgcaaga
gatcactcagaaaagtatagtattcgtcaagaactctatctttgggagtctgttgctgca
acagccaggaaggttcttgggctccgctaccggcttctaccctacttttacacattaatg
tatgaagcacaccaacgaggaacccccattgcgcgtcccattttcttctcgtttcctcaa
gatatcaacacgtatgaaatcagtactcagtttctgattggtgaaggcgtaatggtctca
ccagcattgaaatcagaagcaatttcagttgatgcatactttcctgctggaaattggttc
gacctcttcaactactcgcattctttgagtgttcattcaggaagatatatcaggctcgat
gcaccgcctgatcatataaacgttcatgttcgggaaggtaatattttggccatgcaagga
gcggccatgacaacgcgcatagctcgaaagactccattccagctgttggtggtggtcggc
agtactggaattactactggagaagttttcttggatgatggagaggaggtggtgatggga
ggaaaaggagggatatggagtttagtgagattctttggtggaatagtgggcaacaaggta
tcagtcagttcagaggttgtgaatggaggatatgctttgagccaaaagtggatcatagat
aaggtgactttcataggactggagaagggtaatagattgaagggaacaaaattgaaggga
acaaaattgaacggaaagccagttggaaagacaaatctcgacagccatggacagtttctt
gtggtcgaggtctcaaagctatcacttcttattggaaaggaattcaagttggagctagaa
tttcttaaataa

DBGET integrated database retrieval system