KEGG   Juglans regia (English walnut): 108997501Help
Entry
108997501         CDS       T05245                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00020  Citrate cycle (TCA cycle)
jre00190  Oxidative phosphorylation
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108997501
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108997501
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108997501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like OPA3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 108997501
NCBI-ProteinID: XP_018829362
UniProt: A0A2I4FCI9
LinkDB All DBs
Position
Unknown
AA seq 637 aa AA seqDB search
MWRCVSRGLRVPSSPASFKRSLSNDSLRSHISRFFSTESTVGRSSYTIVDHTYDAVVVGA
GGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKG
SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRC
ACAADRTGHALLHTLYGQSMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFR
SGSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLIT
EGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHL
NHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRGEVVTVKGDD
PNAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANTVAEIQRPGEKQKPLEKD
AGEKTIEWLDKIRNSNGSMPTSKIRLNMQRIMQNNAAVFRTQETLEEGSQLIDKTWESFH
DVQLKDQSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFPKRDDENWMK
HTLGYWEKEKVRLDYRPVHLYTLDDEIEPFPPKARVY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtttctcgaggccttcgagtcccttcttctccggcctctttcaagaga
tcgctgtccaatgactccctcagatctcacatttcgcgcttcttctccactgaatcgact
gtggggcgctcctcatacacaatagttgatcatacgtatgatgccgttgttgtaggagcc
ggtggtgcagggctacgagcagccatagggctttcggagcatgggttcaatactgcctgc
attacaaagctattccctactcgttcgcacactgttgctgctcagggtggtataaatgct
gcattaggaaacatgactgaagacgactggaggtggcacatgtatgacacggtcaaggga
agtgattggcttggtgatcaggatgcaattcagtatatgtgtagggaggcaccaaaagcg
gtgattgagcttgagaactatggattgccattttcacgaactgaagatggaagaatatat
cagcgtgcatttggtggtcagagcttgaattttggaaaaggtggacaggcatatcgttgt
gcatgtgctgccgaccggactggacatgctttattacataccctctatggccagtctatg
aaacataatacccaattctttgtggaatattttgctttggatctattaatgaacagtgat
ggtagctgccaaggagtaattgcgttaaatatggaagatggtacattgcatagatttcgt
tccggttctacaattctggctacagggggttatggtagagcatacttttctgcaacttcg
gctcatacatgtactggagatggcaatgccatggttgcacgtgctgggctcccactcgag
gatttagagtttgtgcagtttcacccaacaggtatatatggtgctggttgcctcatcact
gaaggatcccgtggtgaaggtggtattcttaggaacagtgaaggtgaacgttttatggaa
cgatatgcacctacggcaaaggatcttgcttcaagagatgttgtttccaggtctatgact
atggaaatccgggagggtcgtggtgtaggacctttgaaggaccatatatatctccatttg
aatcacttgccccccgaagtacttaaggagagacttcctggtatctctgaaacagctgca
atatttgctggtgtcgatgttacaaaggagcccattcctgttttgcctactgtgcattat
aacatgggaggaattcccactaattaccgcggcgaggtagttactgttaaaggtgatgac
cccaatgcagtagttccgggattgatggctgctggagaggcagcatgtgcatcagttcat
ggtgccaatagacttggtgcaaattcccttctggacattgttgtttttggacgagcatgt
gcaaacacagttgctgagattcagagaccaggggagaaacaaaaacctttggagaaggat
gctggtgagaagactattgagtggctggacaaaataaggaattcaaatggctcaatgcca
acttcaaaaattcggttgaatatgcaacgaataatgcaaaataatgcagctgtgtttcgt
acacaggaaacattagaagaaggttctcaattgattgacaagacatgggagagctttcat
gatgttcaattgaaggatcagagtttaatatggaactcagacttgatagagactattgag
ttggaaaaccttttgataaatgcttgcatcacgatgcattctgctgaagccaggaaagag
agcagaggggcacatgctcgtgaagattttccaaaaagagatgatgagaactggatgaaa
cacacgttgggatattgggagaaggaaaaggtccggctagattacaggccagttcacctt
tacactttagatgatgagatagagccattcccaccaaaagctcgtgtatattga

DBGET integrated database retrieval system