KEGG   Juglans regia (English walnut): 108999220Help
Entry
108999220         CDS       T05245                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00010  Glycolysis / Gluconeogenesis
jre00053  Ascorbate and aldarate metabolism
jre00071  Fatty acid degradation
jre00280  Valine, leucine and isoleucine degradation
jre00310  Lysine degradation
jre00330  Arginine and proline metabolism
jre00340  Histidine metabolism
jre00380  Tryptophan metabolism
jre00410  beta-Alanine metabolism
jre00561  Glycerolipid metabolism
jre00620  Pyruvate metabolism
jre00903  Limonene and pinene degradation
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108999220
   00053 Ascorbate and aldarate metabolism
    108999220
   00620 Pyruvate metabolism
    108999220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108999220
   00561 Glycerolipid metabolism
    108999220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108999220
   00310 Lysine degradation
    108999220
   00330 Arginine and proline metabolism
    108999220
   00340 Histidine metabolism
    108999220
   00380 Tryptophan metabolism
    108999220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108999220
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    108999220
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108999220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 108999220
NCBI-ProteinID: XP_018831593
UniProt: A0A2I4FIW6
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MAARRLSSLLSRSLSVSGSASLLLSRGTTSCHGRSISRFSTASVAEELITPPVQITYTQN
LINGQFVDAASGKNFPTYDPRTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYE
RSRILLRFADLVEKNTEELAALESWNNGKPYEQAAQAELPMLARLFRYYAGWADKIHGLT
VPADGDYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVLKTAEQTPLTALY
AAKLFHEAGLPPGVLNIVSGFGPTAGAALASHMDVDKLAFTGSTDTGKIVLELAARSNLK
PVTLELGGKSPFIVCEDADIDRAVELAHFALFFNQGQCCCAGSRTYVHERIYDEFIEKSK
ARATRRVVGDPFKKGVEQGPQIDAEQFDKVLRYIRSGIQSNATLECGGDRLGSKGYFIQP
TVFSNVQDDMLIAKDEIFGPVQSILKFKDIDDVIRRANTTRYGLAAGVFTRSLDTANTLT
RALRAGTIWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKKAAWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgcaggctctcctcgcttctgtctcgctctctgtctgtttctgggtctgct
tctctgcttttgtctcgaggaacaacttcttgccatgggagaagcatcagcaggtttagc
actgcttcagtcgccgaggaattaatcactccccctgttcaaataacttatacccagaat
ctgattaatgggcaatttgttgatgctgcatcaggaaaaaactttccaacatatgaccct
cgtactggggaagtgattgcgcatgttgctgaaggtgatgctgaagatatcaaccgtgct
gtagctgctgcacggaaggcatttgatgagggaccgtggccaaagatgacagcttatgaa
agatcacggatattgttgcgatttgctgatttggttgagaaaaacactgaagagcttgca
gctctagagtcatggaacaatgggaagccttatgaacaggctgcacaagctgaattgcca
atgcttgctcgtctatttcgctactatgctggctgggcagataaaatccatggactaaca
gttccggctgatggagattatcatgtgcaaacgttgcatgaaccaattggagttgcagga
caaatcattccctggaactttcctcttctcatgtttgcttggaaagttgggcctgctcta
gcatgtggtaatactgtagtcctgaagacagcagagcaaacacctttgactgctctctat
gcggcaaagctgttccatgaggccggtcttcctccaggcgtattaaatattgtttctggc
tttggtccgactgctggtgcagctcttgccagccatatggatgtggacaagctagctttc
acgggatcaactgatactggaaaaattgtacttgaattggctgcgagaagcaatcttaag
cctgtaacactagagctgggagggaagtcacctttcatagtatgcgaggatgctgatatt
gatagggctgtggagcttgcacactttgctcttttctttaatcagggtcaatgttgctgt
gctggttctcgtacatatgtacatgaacgaatctatgatgagttcatagagaaatcaaag
gcacgtgctacaagacgtgttgtaggtgatcccttcaagaagggtgtggaacaaggtcct
cagattgatgcggagcaatttgataaagtccttaggtacataagatctggaatccaaagc
aatgccacccttgaatgtggaggtgacagattaggctccaaaggctactttattcagccc
actgtcttctccaatgtccaggatgatatgttgatagcaaaggatgagatctttggccca
gtgcaatccatcttgaaattcaaggatattgatgacgtaatacgaagggcaaatacaacg
cgctatggtctagctgcaggagtatttacaagaagcttggacactgctaacaccttgacc
cgagcactaagagctggtacgatatgggttaattgcttcgatgtgtttgatgctgcaatt
ccttttggtgggtacaagatgagtggtataggcagggagaagggaatctacagccttcac
aactacctgcaagtcaaggctgttgttactcctttgaagaaggcagcatggttgtaa

DBGET integrated database retrieval system