KEGG   Juglans regia (English walnut): 108999238Help
Entry
108999238         CDS       T05245                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00562  Inositol phosphate metabolism
jre01100  Metabolic pathways
jre04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108999238
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108999238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:jre01009]
    108999238
Enzymes [BR:jre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108999238
    3.1.3.48  protein-tyrosine-phosphatase
     108999238
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     108999238
Protein phosphatases and associated proteins [BR:jre01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    108999238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 108999238
NCBI-ProteinID: XP_018831636
UniProt: A0A2I4FJ12
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MDSKSADSSASPPLKAPDPPPQASIQTPAAADSGLDNSPHVVPSKLSPSGISAWAKSLKI
PQPLAATQDDSPTGNAGKSTFARFTSGLGLRLSPKAPSSDDSSDGTSMTAQPGFIGTVTK
GLVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFG
YVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVACFPFNDHNCPPIQL
IISFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIDYYNQKRC
FDGKGLVLPSQIRYVKYFERILTYFNGETPPGRRCMLRGFRIHRCPYWIRPSITVSDHNG
VLFSTKSHPRTKDISPEDFWFNAPKKGVMVFTLPGEPGLTELAGDFKVHFHDRQGDFYFW
LNTTMTENRKVLNTNDLDGFDKRKLPSPGFQVEVVLVDYNGTVPTTPNTETIAKKTDESS
GTTTASVDEGAPRPNQKKDKDDVFSDSEAEETGSSKSRQAEAASAGGGTVTNTISSSETK
TNSDQIASVSHATEHISLGNTAGSTQMHVDGQSKSDAVAGAVSVLEVPNTESEFKAMAAD
ASVFTFGDDEDYESE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggattcaaaatctgccgattcatcagcttcacctcctcttaaagcacctgacccacca
ccccaagcttctatacaaactccagctgctgctgattctggactagataattcgcctcat
gttgtaccatctaaattatctccttctggaatatctgcatgggccaaaagtctgaaaatt
cctcagccattggctgccacacaagatgactctccaactggaaatgctggaaagtcaact
tttgcacgttttaccagtggattaggattgcgcttgtctccaaaagccccttcttcagac
gatagttctgatggaacttcaatgactgcacaacctggttttattggaactgttacaaaa
ggattagtagattcttctaagaatgcagtaaaggctgtacaggtgaaggctcggcatgtt
gtctctcaaaataaacgaagataccaggaaggaggatttgatctggatatgacttatatc
actgagaatataattgcaatggggttccctgctggtgatatgagctctggatttttcggt
tatgttgaggggttctaccgaaaccacatggaagaagtaatcaaattctttgaaactcat
cacaaggacaagtacaaagtgtacaatctttgttctgagaggctgtatgatgcgtcctta
tttgaaggaaaggtggcttgtttcccgtttaatgatcataattgccccccaattcaactg
ataatatcattttgccaaagtgcttactcatggttgaaggaggatatcgagaatgttgtg
gttgtgcattgcaaggctggaatggcaagaacagggttgatgatttccagtcttcttcta
ttcttgaagttcttcccaactgctgaggagtcaattgactactacaatcagaaaagatgt
ttcgatggaaaagggcttgttctgccaagtcagattaggtacgtcaaatattttgagcgt
attttaacatacttcaatggtgaaacccctcctgggcgaaggtgcatgcttaggggattt
cgaattcacagatgtccctattggatcaggccctccattactgtttctgatcataatggt
gttctcttttccacaaaaagtcatccacgaaccaaggatatttcgccagaagatttttgg
tttaatgcacccaagaagggggtaatggtcttcactttgccaggggagcctggccttaca
gagctagctggggacttcaaagtccattttcacgaccgccaaggcgatttctacttttgg
ttaaacacaacaatgacagaaaatagaaaagttttaaacacaaacgatctcgacgggttt
gacaagaggaaacttccttcccccggatttcaggttgaggttgtgcttgttgattataac
ggcactgtccctacaacacctaacactgaaactattgctaagaaaacggatgaaagctcg
ggcactactactgcttcagttgatgagggtgcacccagaccaaaccaaaagaaagataaa
gatgatgtcttttcagatagtgaggcagaggaaactggttcctcgaagagcaggcaagca
gaagctgcttctgcaggaggaggaactgtcaccaataccatctccagttctgagacgaag
acaaattcagatcaaattgcaagtgtgagtcatgcaaccgaacatatatctctggggaac
actgctggctccacacagatgcatgttgatgggcagagtaaaagtgatgccgtcgccgga
gctgtctcagtccttgaggtgcccaacacagaaagtgaattcaaggcaatggcagctgat
gcttctgttttcacatttggagatgatgaggactatgaaagtgagtaa

DBGET integrated database retrieval system