Juglans regia (English walnut): 109000873 Help Entry 109000873         CDS       T05245                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism jre  Juglans regia (English walnut) Pathway jre04136   Autophagy - other Brite KEGG Orthology (KO) [BR:jre00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     109000873  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jre04131]     109000873    04121 Ubiquitin system [BR:jre04121]     109000873    03029 Mitochondrial biogenesis [BR:jre03029]     109000873 Membrane trafficking [BR:jre04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     109000873 Ubiquitin system [BR:jre04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    109000873 Mitochondrial biogenesis [BR:jre03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     109000873 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  109000873 NCBI-ProteinID:  XP_018833434 UniProt:  A0A2I4FP44 LinkDB All DBs Position 12:complement(26038298..26040458) Genome browser AA seq 97 aa AA seqDB search MATVEIQSPSSVRKVVVHLRATGDAPILKQVKFKIPGSDKFAKVIDFLRRQLHRETLFVY VNSAFSPNPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggccactgttgagattcagtctccgagttctgtgcggaaagttgttgttcatcttaga gctactggcgatgcccctatactcaaacaagtcaaatttaagatacctggaagtgacaag ttcgctaaagtaattgactttctacggcggcagcttcatcgggagacgttgtttgtttat gtcaacagtgcgttctcgccaaacccagatgaattggtaatcgatttgtataacaatttt ggttttgatggtaaactggtggtaaattatgcttgttccatggcatggggctaa

DBGET integrated database retrieval system