KEGG   Juglans regia (English walnut): 109000874Help
Entry
109000874         CDS       T05245                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00010  Glycolysis / Gluconeogenesis
jre00051  Fructose and mannose metabolism
jre00052  Galactose metabolism
jre00500  Starch and sucrose metabolism
jre00520  Amino sugar and nucleotide sugar metabolism
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
Module
jre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
jre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109000874
   00051 Fructose and mannose metabolism
    109000874
   00052 Galactose metabolism
    109000874
   00500 Starch and sucrose metabolism
    109000874
   00520 Amino sugar and nucleotide sugar metabolism
    109000874
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109000874
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:jre04131]
    109000874
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109000874
Membrane trafficking [BR:jre04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109000874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109000874
NCBI-ProteinID: XP_018833437
UniProt: A0A2I4FP93
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MSVAATYPAVGSFCLLRSLRRTPRFRMAVRSSTISVGPLLTKLKHDCATPLPVLRHMADA
MAADMRSGLAIDGGSDLKMILSYVDSLPTGNEKGLFYALDLGGTNFRVLRVQLGGKEEGV
IATESEQVSIPQDLMFGTSEELFNFIASGLGKFAQREGGKFSMQSGRKREIGFTFSFPVR
QTSIDSGILIKWTKGFAVSGTAGRDVVACLNEAMERQGLEMQVSALVNDAVGTLAGARYW
DDDVMVAVILGTGTNACYIERMDAIPKLQSHVSSSGRTIINTEWGAFSKGLPLTVFDRDM
DAATINPGEQIFEKTISGMYLGEIVRRVLLKMAEEGALFGDSSPEKLSTPFVLRTPDVCA
MQQDDSEDLKVVGSILHDLASVESNVSARKIVVEVCDTIVKRGGRLAGAGIVGILQKMEE
DSKGLIFGKRTVVAMDGGLYEHYPQYRRYLQDAVTELLGSELSKNVVIEHTKDGSGIGAA
LLAAANSMYGHDL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgccgcgacctaccccgcagtcggatcgttttgtctcctacgatccctccgg
cgtacgcctcggttcaggatggccgttcgatctagcacgatctccgtcggcccattactc
accaagttaaagcacgactgtgcaactcccttgcctgtcctccgccacatggcggacgcc
atggctgccgatatgcgctctgggcttgcgattgacggtggcagtgatctcaagatgata
ctcagctatgttgacagtctcccaactgggaatgagaaagggttgttctatgcgctggat
cttggtggaacaaactttcgggtgctgagggtgcagttgggtgggaaggaagagggtgtg
atcgcaaccgagtccgagcaagtatcgattcctcaagatctcatgtttggtacctctgag
gagcttttcaattttattgcttctgggttgggaaaatttgctcaaagggagggcgggaag
tttagcatgcaatctggaaggaaaagagaaattggattcacattttctttccccgtgagg
cagacgtctatagattctggcatactaatcaagtggaccaaggggtttgctgtctctgga
acggccggaagagatgtagtggcttgtttgaatgaggcaatggaaaggcaaggactggag
atgcaagtatctgccctggttaatgatgcagtcgggacgttagctggagcaaggtactgg
gatgatgatgtcatggttgccgtcattttgggtactggaacgaatgcttgctatattgaa
cggatggacgctattcctaagcttcagagtcatgtgtcttcttcgggaagaacgattata
aatactgagtggggagcattctcaaaaggtcttcctttaactgtttttgatagagatatg
gatgctgcaactattaatcctggtgagcagatctttgagaagacaatctctggaatgtat
cttggtgaaattgtaagaagagtgctactgaagatggctgaagaaggagctctgtttggt
gattcttctccggaaaaactgtccacaccgtttgtactccggaccccagatgtttgtgct
atgcagcaggatgactctgaagatcttaaagttgttggctcaattctccatgacttggct
tcggtcgagagcaacgtgagtgcaaggaagattgtcgtggaggtttgcgacactatagtg
aagagaggtggccgcttagctggtgcaggaattgtgggaatcctgcaaaagatggaggag
gattcaaaaggtctgatatttgggaagaggacagtggtggctatggatggaggcttgtat
gaacattacccccagtacagaagatacctgcaggatgcggttacagagcttctagggtcg
gaattatcaaagaatgtggttatagaacacactaaagatgggtctggtataggagctgct
ctcttggcagcagccaactcgatgtacggtcacgacttgtag

DBGET integrated database retrieval system