KEGG   Juglans regia (English walnut): 109005024Help
Entry
109005024         CDS       T05245                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:jre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109005024
Enzymes [BR:jre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109005024
Chromosome and associated proteins [BR:jre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109005024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 109005024
NCBI-ProteinID: XP_018839332
UniProt: A0A2I4G602
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MPATKKNLEHIHVGGVFNNLMKQIGNPVDFELPDWFNKWKPTPYTFIKRNIYLTKRIKRR
LEDDGIFCSCSVSPGSSSVCGRDCHCGMLLSSCSTGCKCGSSCLNKPFQNRPVKKMKLVK
TEKCGSGIVADEDIKQGEFVIEYVGEVIDDKTCEERLWNMKHRGETNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRNIKKGEHLTYDYQFVQFGADQD
CHCGAAGCRRKLGVRPTKPKMSSDAALKLVAYQVYRNGGLHVGSSHIRNQQRTSSRNCIG
EVIRITRPMNERSFGIIKRFDKFSKRHSIMFEDGAVEFLDMTKEDWDFVRS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctacaaagaagaatcttgagcatattcacgttggaggtgtattcaacaatttg
atgaagcagattggaaatcctgttgattttgaacttccagattggtttaacaaatggaag
ccgacgccctacacttttataaagcgcaatatatatctcacaaagaggattaaaagacgc
ctcgaggatgatggtatattctgttcctgcagtgtttcacctggatcttctagtgtgtgt
ggtagagattgccattgtgggatgcttctctctagttgctccactggatgtaaatgtggg
agttcatgccttaacaaaccattccagaaccgacctgtgaagaagatgaaactggtgaag
actgagaaatgtggttctggaatagtggcagatgaagatatcaaacaaggagagtttgtg
atagaatatgttggagaagttattgatgacaagacgtgtgaggaaaggctttggaatatg
aaacaccgtggagagacaaacttttacttgtgtgaaattaatcgagatatggtaattgat
gcgacatacaagggaaacaagtcaagatatataaaccatagttgttgtccaaataccgag
atgcaaaaatggataattgatggggaaacaagaattggcatatttgcaacccgcaacata
aaaaagggcgaacatctgacctatgattatcagtttgttcagtttggtgcagatcaagat
tgccattgtggtgctgctggctgcaggagaaagttaggggtcagacctaccaagcctaag
atgtcttcagatgccgcattgaaactagtagcataccaggtttatcggaatggaggatta
catgtagggagttcgcatattcgtaaccagcaaagaacaagctcccgtaattgcattggt
gaagttattaggataactcgccccatgaacgagaggtcctttgggattattaaacgtttt
gataaattttccaaaagacactcgattatgtttgaagatggagctgttgaatttcttgac
atgacaaaagaagattgggattttgtgagatcgtga

DBGET integrated database retrieval system