KEGG   Juglans regia (English walnut): 109008918Help
Entry
109008918         CDS       T05245                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00020  Citrate cycle (TCA cycle)
jre00190  Oxidative phosphorylation
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109008918
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109008918
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109008918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 109008918
NCBI-ProteinID: XP_018844747
UniProt: A0A2I4GLH0
LinkDB All DBs
Position
Unknown
AA seq 304 aa AA seqDB search
MSALLDFVLYPRRPAYQRVHFSVSLGRKTVMATGLFRRTISRVSASRFVWVRAHASEAEA
QQVEARASTTLKTFSIYRWNPDSPSKPELQDYQIDLKECGPMVLDALIKIKNEVDPTLTY
RRSCREGICGSCAMNIDGCNGLACLTKIPSSGSATTITPLPHMFVIKDLVVDMTNFYNQY
KSIEPWLKRKTPPVKGKEILQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAA
LLHANRWISDSRDEYTAERLEAINDEFKLYRCHTILNCARACPKGLNPGKQIIHIKQLQL
SGGA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgttattagatttcgtactttatcccagacgaccagcctatcagagagttcat
ttctccgtctcccttggtcggaagacagtaatggcgacgggtctgttcaggagaacaatc
tctagggtgtccgcatcaagattcgtgtgggtccgggcccacgcgagcgaggccgaggcg
cagcaggtggaggctcgcgcctccacgactctcaagaccttctccatctaccggtggaac
ccggacagcccgtcgaagcccgagctccaggactaccaaattgacctgaaggagtgcggg
cccatggtcctcgacgccctcatcaagatcaagaacgaggtcgaccccaccctgacgtac
cgacgctcgtgccgggagggcatctgcggttcctgcgcgatgaacatcgacggctgcaac
ggcctcgcttgcctcaccaagatcccgtcatccgggtcggcgacgacgatcacgccactg
ccacacatgtttgtgattaaggacctggtggtcgacatgaccaacttctacaatcagtac
aagagcatcgagccctggcttaagaggaagactccacccgtgaaaggcaaggagattttg
cagagcaagaaggatagggccaagctggatgggatgtacgagtgcattctctgcgcctgc
tgcagtacatcctgccccagttattggtggaaccccgagtcttatcttggccccgccgct
ttgctccacgctaatcggtggataagtgatagccgtgatgaatatacggccgaacggctg
gaggctataaatgacgagttcaagctctaccgctgccataccatactcaactgtgcccgt
gcctgtccgaagggcttgaaccctggaaagcagatcattcatatcaagcagctccaacta
tctggtggcgcttga

DBGET integrated database retrieval system