KEGG   Juglans regia (English walnut): 109013849Help
Entry
109013849         CDS       T05245                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00564  Glycerophospholipid metabolism
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109013849
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109013849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox GIDA HI0933_like Lycopene_cycl Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 109013849
NCBI-ProteinID: XP_018851614
UniProt: A0A2I4H645
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MATAFRLSRRLGAAAIATAAGGAVLLYQPTLAANDRGGGPQLAAIRQKISDPNAVIPSRT
VQESALIGTSSANPLDVLVIGGGATGCGVALDAVTRGLRVGLIEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGPRLLHLSRYYSAQESSELFPTLARKGKDRNLKGTVVYYDGQMNDSRLNLG
LACTAALAGAAVLNHAEVVSFLKDEVGERIIGARIRDNLSGKEFNSYAKVIVNAAGPFCD
SVRKMANKDARSMISPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTT
DSNTPITLLPEPHEDEIQFILDAISDYLNVKVRRMDVLSAWSGIRPLAMDPSAKNTESIS
RDHVVCEDYPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLSPTSNCLTHNLQLVGGDGWD
PASFTVLAQQYVRMKKTHGGKVVPGVMDTAAAKHLSHAYGTLAEQVAAIAQNENLGKRLA
HGYPFLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAAGRALPRIIEILATEHKWDKS
RRKGEFQKATEFLSTFKSAKNAQFHDGKHI
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcctttcgcctgagccgccgccttggtgccgcggcaattgctaccgcagcc
ggaggggcagtcctcctctaccagcccacgttagccgccaacgaccgcggtggtggcccc
cagctcgcggctattaggcagaagatcagcgacccaaacgccgtcattccgtccagaacg
gtccaggagtcggctctaatcgggaccagctcggctaatccactcgacgtcctcgtgatc
ggcggcggggccacaggatgcggcgtcgccctcgacgcggtcaccaggggcctccgagtc
gggcttatcgagcgagaggatttctcttctggcacatcctcgaggtccacaaagctcatt
catggaggagttcgttacttggagaaagctgtctttaatcttgactatgggcaattgaag
ctggtatttcatgcgcttgaggaacgtaaacagcttattgagaatgcaccacacctatgc
catgcattaccatgcatgacaccatgttttgactggtttgaggtagtatactactggatg
ggcttgaaaatgtacgatttggtcgcaggaccacgcctattgcatttgtccagatattat
tctgcacaagagtccagtgagctcttccccacacttgccaggaagggtaaagatagaaat
ctaaagggaacggtggtttattatgatggccagatgaatgactcacgacttaatcttgga
ttggcatgcactgcggcattagctggtgcagcggtgcttaaccatgcagaggtagtatca
tttttgaaagatgaagttggcgagcgcataattggtgcacggattcgagacaatttatca
ggcaaagagttcaactcgtatgcaaaagtaattgtcaatgcggctgggccattttgtgat
tctgtgaggaaaatggccaataaagatgcacgatctatgatcagtcctagcagtggtgtg
catattgttcttcctgattactattcacctgaaggaatgggtttgattgttcctaaaact
aaggatggacgtgttgtcttcatgctgccatggttgggacgaacagttgctggaactaca
gattccaacactcccatcactttgcttccagaaccacatgaagatgaaattcaatttata
ttggatgccatcagtgactatcttaatgttaaggtaaggcgaatggatgttctttcagca
tggagtggtatacgcccattggcaatggacccatccgccaaaaacacagagagtatctcc
agggatcacgttgtctgcgaagattatcctggcttggtcacaattacgggtgggaagtgg
actacgtaccgtagcatggcagaagatgcagttaatgcagccataaagtctggaaagctg
agcccaaccagtaattgtttaactcacaacctgcagcttgttggtggagatggatgggat
cctgcatcatttacagttcttgcacaacagtatgtacgcatgaagaagactcacggtgga
aaagtcgttcccggtgtaatggacactgcagcagcaaagcatttgtctcatgcatatgga
actttggctgaacaagtggctgccatagctcagaatgaaaacctggggaagaggcttgcc
catggatatccttttctcgaggctgaggttgcgtactgtgctcggaatgaatactgtgaa
tctgctgttgatttcattgcgaggagatcccggcttgctttccttgacaccgatgcagca
ggtcgggcattgccgcgcataattgagatattggctactgagcacaagtgggacaagtca
aggcggaagggagagtttcagaaggctacagaatttttgtctactttcaagtcagcgaag
aatgctcaattccatgatggaaaacacatatag

DBGET integrated database retrieval system