KEGG   Juglans regia (English walnut): 109016663Help
Entry
109016663         CDS       T05245                                 

Definition
(RefSeq) methionine gamma-lyase-like
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00270  Cysteine and methionine metabolism
jre00450  Selenocompound metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    109016663
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109016663
Enzymes [BR:jre01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     109016663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 Met_gamma_lyase Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 109016663
NCBI-ProteinID: XP_018854596
UniProt: A0A2I4HES3
LinkDB All DBs
Position
Unknown
AA seq 330 aa AA seqDB search
CTSSGMAAISSVLLQLLSSGGHVVASTVLYGGTHALLTHFLPRACNIKTTFVDMNNLESV
SNAIVQGRTKVLYFESISNPTLSVANIPELSRIAHEKGVKVVVDNTFAPMVVSPARLGAD
VVIHSITKFISGGADIIAGAVCGPASLVNSMMDLHQGTLMLLGPTMNPKIAFELSERIPH
LSLRMKEHCHRALVFATRMKKLGLKVIYPGLEDHPHHTLLKSFANKDYGYGGILCIDMET
EERANRLMHHLQNSTQFGFLAVSLGYYETLMSCSGSSTSSEMNDEEKALARISPGLVRMS
VGYLGTLEQRWSQLEKAISRIQDSGSLNKY
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
tgcacctccagcggcatggccgcgatatcctctgtactcctccaactcctcagcagtgga
ggccacgtcgtcgcctccacggtcctctacggcgggacccacgccctgctgacccacttc
ctccccagggcgtgcaacattaagacaacgttcgtggacatgaacaatttggaatcggtg
agcaacgccatcgtccaaggccgaaccaaggtgctgtacttcgagtccatctcgaacccc
acgctgagtgtggctaacatacccgagctgagccgtatagcacacgagaagggagtcaag
gtcgttgtcgacaacaccttcgctcccatggtggtctcgcctgctcggctcggcgccgac
gtcgtgattcacagtatcaccaaattcataagcggtggggccgacattattgcaggagct
gtgtgtgggcctgcaagtcttgtgaactccatgatggacctccaccaagggaccctgatg
cttttggggcctacaatgaaccccaaaattgcattcgaactatctgagagaattccccac
ttgagcctaagaatgaaggagcattgccaccgagcactggtcttcgccacaaggatgaag
aagctgggccttaaggtcatctacccagggcttgaggaccacccgcaccacacccttttg
aagtcctttgccaacaaagactatggctacggtgggattctttgcattgacatggagacc
gaggaaagggctaacaggctgatgcaccacttgcaaaatagcacccagtttgggttcctg
gcagttagcctgggatattatgagacccttatgtcctgctcaggcagtagcaccagcagt
gagatgaatgatgaggagaaggcgctggcccgaatttcaccagggttggtgaggatgtca
gtcggataccttgggacattggagcagaggtggagccaactcgagaaggcgatttccaga
atacaggactcaggttccttgaacaaatactga

DBGET integrated database retrieval system