KEGG   Juglans regia (English walnut): 109021270Help
Entry
109021270         CDS       T05245                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:jre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109021270
Enzymes [BR:jre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109021270
Chromosome and associated proteins [BR:jre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109021270
   Polycomb group proteins
    PRC2-EZH2 complex
     109021270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 109021270
NCBI-ProteinID: XP_018859418
UniProt: A0A2I4HTE6
LinkDB All DBs
Position
Unknown
AA seq 730 aa AA seqDB search
MIYTRCEMKLTSLVAFCCGIASMTVKEVGLSDQVLESLAQCFSRSPCEVKARYETLIKEE
KAVEGSKNGDNEDILHNGNSLLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPTE
KQPSWRPTDEENIPCGLHCYRSALKSQRIARGSSSINGDFEEKSAPSSGSAGAQISSRKK
APGPSARKKVKSCQSESASSNAKNVSESSDSENGPGHDTTSTHQSSPRKTKLSGKCGIGK
RNSKRVAERVLVCMQKKQKKMVASDDCDSFVSGGLCPGEMKPKSNACKENDDTSSSMHKN
VKSPSSGRLRRKESSIQASHKVVLGEVPDGSSNDMITDPPAASSDDNSRKEEFVDENAYK
QESSDNKSWKAFEKGLFEKGVEIFGRNSCLIARNLLNGMKTCWEVFQYMNCSESKLSCQA
GDGANSLIEGYSKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRITERKDQPCRQ
YNPCGCQTACGKQCACLQNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRE
CDPDVCRNCWVSCGDGTFGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNS
VSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSP
DPNCYAKVIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASGSKKEEGA
PSSGRAKKLA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgatatatactagatgtgaaatgaaacttactagtcttgtggcattctgttgtggcatt
gccagcatgactgtcaaggaagttggtttatcagatcaagtgctggaatcactagcacaa
tgtttttctagaagcccttgtgaagtcaaggcaagatacgaaactcttattaaggaagag
aaggctgtggaaggttctaagaatggtgataatgaagacattttgcataatgggaattct
cttcttgataaagatcttgacgcagctttggattcttttgacaacctattttgtcgccga
tgtcttgtttttgattgcagattacatggatgctcacaggatcttgtctttcctactgag
aaacaaccttcatggcgccctacagatgaggaaaatataccatgtggcctacattgctat
cgatctgcattgaagtcgcaaagaatagctagagggagctcttccattaatggtgatttt
gaagaaaaatctgccccttcatctggtagtgctggggctcagatatcatccaggaagaag
gctcctggtccatctgctagaaagaaggtgaagtcctgccaaagtgaaagtgcttcatca
aatgcaaagaatgtatcagaaagcagtgactccgagaatggccccgggcatgacaccact
tctacccaccagtcatcacctcgcaaaactaagctttcaggaaaatgtggaattggtaag
aggaacagcaagcgagttgccgaacgtgttctagtttgcatgcagaaaaagcagaagaaa
atggtagcttctgatgattgtgattcctttgtgagtggaggtctttgtcccggcgagatg
aaacctaaatctaatgcatgtaaggaaaatgatgatactagttcttctatgcataagaat
gtgaaatccccatctagtggaaggttgagaaggaaggaatcatcaattcaagccagtcac
aaggttgtgctgggtgaggttcctgatggttcatcaaatgatatgattacagatccacct
gctgctagcagtgatgacaactcgaggaaagaagagttcgtagatgaaaatgcatataaa
caagaatcgagtgataataaatcttggaaagcttttgaaaaaggcctttttgagaaaggc
gtcgaaatttttgggaggaatagttgtttaattgctaggaaccttctaaatggtatgaag
acatgttgggaggtttttcaatacatgaattgctctgagagtaagctgtcctgccaagct
ggtgatggtgcaaactctcttattgaaggctattctaagggtaataatgaagtgagaaga
agatcaagatttttacgtaggaggggtagagttcgtcgcttgaagtatacctggaagtct
gctgcttaccattcaatccggaaacgaattactgagagaaaagatcagccatgccggcag
tacaatccatgtggttgccaaactgcttgtggcaagcagtgtgcttgtcttcaaaatggg
acctgctgtgaaaagtactgtggatgtccaaagagttgcaagaaccgttttagaggctgc
cattgtgctaaaagtcaatgtcgaagtcgtcagtgtccgtgctttgctgcagacagagaa
tgtgatccagatgtttgtaggaattgttgggtcagctgtggagatggtacttttggggtt
ccaagccaaagaggtgataattatgaatgtagaaatatgaagcttcttctaaaacagcaa
caaagggttttacttggtagatctgatgtatctggctggggagctttcctaaagaatagt
gtaagcaagcatgaatatcttggtgaatacactggggagctaatttcgcatcgagaagca
gataaacgtggaaagatttatgaccgtgaaaattcgtcatttctcttcaatctgaatgat
cagtttgtccttgatgcataccggaagggtgacaaattgaagtttgccaaccactctcca
gatccaaattgttatgctaaggttattatggttgccggggatcaccgagttggtatattt
gccaaggaacgaatttgtgctggggaggaactcttttatgattatcgatacgaaccagac
agagctcctgcctgggctcgaaagccggaggcatctggatcaaaaaaggaggagggtgct
ccttcaagtggccgtgccaagaagctcgcttaa

DBGET integrated database retrieval system