KEGG   Janthinobacterium svalbardensis: CNX70_00360Help
Entry
CNX70_00360       CDS       T05119                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jsv  Janthinobacterium svalbardensis
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CNX70_00360
Enzymes [BR:jsv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CNX70_00360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO HI0933_like Thi4 FAD_binding_3 NAD_binding_8 K_oxygenase NAD_binding_7 AlaDh_PNT_C Glutaredoxin FMO-like Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ATD58814
UniProt: A0A290WPM9
LinkDB All DBs
Position
complement(82772..84367)
Genome map
AA seq 531 aa AA seqDB search
MLDATLKTQLKSYLEKVVYPLELVASLDDSAKAREMKELLQEIVLLSDKITLVERLDAGV
RVPSFSINRTGSDIGVRFAGVPLGHEFTSLVLALLQVGGHTIKFDDAVIEQIRNLDGDYE
FETFISLSCHNCPEVVQALNAMAVINPRIKVTTIDGGVFPKEVEERQIMAVPMMFLNGQH
FGQGRTNVEEILAKLDTNAGARQAAALSKKDVFDVLIVGGGPAGAAAAIYAARKGIKTGV
LAERFGGQTLDTMAIENFISVKETDGPKFAMALEQHVKTYDVDIMNTQRASKLTPGKLIE
IETANGAILKAKTVILATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVKHVTLIEFGAELRADAVLQRKLHSLPNVTVITSAQTTEIHGDGKIV
NGLSYTDRVSGESKKVELEGVFVQIGLVPNTEWLKGTVALSRHGEIEVDARGQTSIPGVF
AAGDVTTVPYKQIIIATGEGAKAALSAFDHLIRSDDEEVVEEAAVKEALTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaccctcaaaacccaactgaaatcctacctggaaaaagtggtgtatccg
cttgagctggtcgcttctctggatgacagcgcaaaagcccgcgagatgaaggaattgctc
caggagatagtcctgttgagcgacaagatcacgctggtcgagcgccttgacgctggcgta
cgggtgccgtcgttcagcatcaaccgtaccggctccgatatcggcgtgcgtttcgccggt
gtgccgctgggccacgaatttacctcgctggtgctggcgctgctgcaagtgggcggccac
accatcaagttcgacgatgccgtgatcgagcagatccgcaacctcgacggcgattacgag
tttgaaacgtttatttcgctctcctgccataactgcccggaagtggtgcaggcattgaat
gccatggcggtgatcaacccgcgcatcaaggtcaccaccatcgatggtggcgtgttcccg
aaagaagtggaagagcgccagatcatggccgtgccgatgatgttcctgaatggccagcat
tttggccagggacgcacgaatgtcgaggaaatcctcgccaagctcgacaccaacgccggc
gcacgccaggcggcagcgttgagcaagaaagatgtctttgatgtactgatcgtcggcggc
ggtcctgccggcgcggcagcggccatctacgcggcgcgcaaaggcatcaagacgggcgtg
ctggccgagcgtttcggcggccagaccctcgacaccatggccatcgagaattttatttcc
gtcaaggaaaccgatggtccaaagtttgcgatggcgctggaacagcacgtcaagacctat
gacgtcgacatcatgaacacccagcgcgccagcaagctgaccccaggcaagctgatcgag
attgaaacggcgaatggcgccatcctgaaagccaagaccgtcatcctggccaccggtgcc
cgctggcgcgaaatcaacgtgccgggcgagaaggaataccgcaaccacggtgtcgcctac
tgcccgcactgcgatggccccttgttcaagggcaagcgcgtggccgtgatcggcggcggc
aactcgggtgtagaagcggcgatcgacctggccggcctggtaaaacacgtgaccctgatc
gagttcggtgcggaattgcgtgccgatgcggtgctgcaacgcaagctgcacagcctgcct
aacgtgaccgtgattacctcggcgcaaaccaccgagatccacggcgacggcaagatcgtc
aatggcctgagctacacggaccgggtcagcggcgagtcgaaaaaggtcgagctggaaggc
gtcttcgtgcaaatcggcctggtgccgaacacggagtggctgaaaggcacggtagcgttg
tcgcgccacggtgaaatcgaagtcgatgcccgcggccagacctcgatccccggcgtattt
gcggccggcgacgtcaccacggtgccgtacaagcagatcatcatcgccaccggcgaaggc
gccaaggccgccctgtccgcctttgaccacctgatccgctcggacgacgaggaagtggtt
gaagaagccgcagtaaaagaagcgctgacggcataa

DBGET integrated database retrieval system