KEGG   Janthinobacterium svalbardensis: CNX70_05685Help
Entry
CNX70_05685       CDS       T05119                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00473  D-Alanine metabolism
jsv00550  Peptidoglycan biosynthesis
jsv01100  Metabolic pathways
jsv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CNX70_05685
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CNX70_05685
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CNX70_05685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jsv01011]
    CNX70_05685
Enzymes [BR:jsv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CNX70_05685
Peptidoglycan biosynthesis and degradation proteins [BR:jsv01011]
 Precursor biosynthesis
  Amino acid ligase
   CNX70_05685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_4 RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ATD59734
UniProt: A0A290WS71
LinkDB All DBs
Position
1283521..1284489
Genome map
AA seq 322 aa AA seqDB search
MNQASAIDVKQLGKVGVLFGGSSAEREVSLMSGTGVLAALKSRGVDAHAFDTGERSLAEL
AAEQFDRVFIALHGRFGEDGSLQGALEQLGIPYTGSGVMACAVGMDKVYTKMIWLMHQLP
TPQYAVLNDSSDLAKVAAELGLPLIVKPPHEGSSIGITTVNEASAFQAAYDIAAGLDDSV
LAEEFIKGREFTVAILGQGATARALPPIEIVAPQGNYDYQNKYFTDDTQYFCPPQLDQTI
VAEMERIAVAAYRALGCEGWGRVDVLMRAADSKLFLLEVNTSPGMTGHSLVPMAARALGI
SYEDLCLEILAGARLKMHKGQH
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccaagcttcagctatcgacgttaaacaattgggcaaggtcggcgtcctgttcggc
ggcagctcggccgagcgcgaagtgtcgctgatgtccggcacgggcgtgctggctgcactg
aaaagccgtggcgtggatgcgcatgcgttcgacacgggcgaacgcagcctggccgaactg
gccgccgagcagtttgaccgggtcttcatcgcgctgcacggccgcttcggcgaagacggc
agcctgcagggcgcgctggagcagctgggcattccctacacgggtagcggcgtgatggcg
tgcgcggtgggcatggacaaggtctataccaagatgatctggctgatgcaccagttgccg
acgccacagtacgcggtgctcaatgacagctccgacctggccaaggtggcagctgaactg
ggcttgccgctgatcgtcaagccgccgcatgagggttcgagcatcggcatcaccaccgtc
aacgaagcatcggccttccaggcggcctacgatatcgccgccggcctcgatgattcggtg
ctggccgaggaattcatcaagggccgcgaattcaccgtcgcgatcctgggccagggcgcc
acggcacgcgcgctgccaccgattgaaatcgtcgcgccgcaaggcaattacgattaccag
aacaagtacttcacggacgacacgcagtatttctgcccgccgcagctggaccagacgatc
gtggcggaaatggaacgcatcgccgtggcagcctaccgtgccctcggctgcgaaggctgg
ggacgtgtggatgtgctgatgcgcgcggccgacagcaagctgttcctgctggaagtcaat
acctcgccaggcatgacgggccattcgctcgtgccgatggcggcgcgcgcgctgggcatc
agctatgaagacctgtgcctggaaatcctcgccggcgcgcgtctgaaaatgcacaaggga
cagcactga

DBGET integrated database retrieval system