KEGG   Janthinobacterium svalbardensis: CNX70_10520Help
Entry
CNX70_10520       CDS       T05119                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00620  Pyruvate metabolism
jsv00680  Methane metabolism
jsv01100  Metabolic pathways
jsv01120  Microbial metabolism in diverse environments
jsv01200  Carbon metabolism
Module
jsv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNX70_10520
  09102 Energy metabolism
   00680 Methane metabolism
    CNX70_10520
Enzymes [BR:jsv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CNX70_10520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATD60561
UniProt: A0A290WUL4
LinkDB All DBs
Position
complement(2334019..2336859)
Genome map
AA seq 946 aa AA seqDB search
MLNDAVAPEIVPAASSDKDAPLKEDIRLLGRLLGDVLREQEGDAVFNVVETIRQTSVRFR
READADAALELDAMLKELSREQTISVVRAFSYFSHLANIAEDQHHIRRRRAHLLAGSPAQ
KGSISFALKKLRAAGVPRATVDTFFQEALIAPVLTAHPTEVQRKSILDAEHDIARLLAER
DLPQTPKERQANMQLLRSRVATLWQTRMLRYSKLTVADEIENALSYYRITFLRELPGLYD
DIEDDIACEYPNGDGTIEPINAAYVQMGSWIGGDRDGNPNVNAGTMQHALARHATTILDF
YLDEAHALGAELSVSTLMVGVSAELQALADQSPDASPHRSDEPYRRALIGIYARLAATAR
ALGATNILRKEVGPAAAYPDAAAFVADLRTIVASLESHHGAALVRPRLATLARAADIFGF
HLASLDMRQTSDVHERVLADLFAHSGVAADYTALSEEDKQALLLSELAQPRLLYSPYISY
ATETDSELAILRAARDIRQRYGARAIRNYIISHTETVSDLLEVLLLQKETGLLRTDWQAG
ESTCELMVIPLFETIPDLQRAAGIMSQVMALPLVKQLIAKQGQLQEVMLGYSDSNKDGGF
LTSNWELYKAELALVADFRKAGVKLRLFHGRGGTVGRGGGPSYEAILAQPPGTVNGQIRL
TEQGEIIASKFSNAEIGRRNLELLVAATLEASLAPQAANPAHASELAQFEAVMAELSDLA
YHAYRHLVYETPGFTEYFFSATPIAEIAELNLGSRPASRKANQRIEDLRAIPWGFSWGQC
RLLLPGWFGFGSAIEAWINQADGASKDEKIATLRAMYAEWPFFATLLSNMDMVLAKTDLA
IASRYAELVADQDLRERIYKRITDEHGNTLRCLELITGNTERLAGNPLLARSIQNRFAYL
DPLNHLQVELIKRNRALSAESKIDERVHRGIQLSINGVAAGLRNTG
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgacgcagtagcaccagaaatagttccagcggccagctccgacaaggacgcg
ccactgaaagaagacatccgcctgctgggccgcctgctgggcgacgtgctgcgcgaacag
gaaggcgacgccgtcttcaatgtggtggaaaccatacgccagacgtccgtgcgcttccgc
cgcgaagccgacgcggacgccgcgctggaactcgacgccatgctgaaagaactgagccgc
gaacagacgatttccgtggtgcgcgccttttcctatttttcacacctggccaacattgcg
gaagatcaacaccacatccgccgccgccgtgcccatttgctggccggctcgccagcgcaa
aagggcagcatcagcttcgcgctgaaaaaactgcgcgccgccggcgtgccgcgcgccacc
gtcgacaccttcttccaggaggcgctgatcgcccccgtgctgacggcccacccgacggaa
gtgcagcgcaagagcatcctcgacgccgagcacgacatcgcccgcctgctggccgagcgc
gacctgccgcagacgccgaaagagcggcaagccaacatgcagctgctgcgctcgcgcgtc
gccaccctgtggcagacgcgcatgctgcgctactcgaagctgacggtggccgacgaaatc
gaaaacgccctgtcctactaccgcatcacctttttgcgcgaactgccgggcctgtatgac
gacatcgaggacgatatcgcttgcgagtacccgaacggtgacggcaccatcgaaccgatc
aatgccgcctacgtgcagatgggcagctggatcggcggcgaccgcgacggcaacccgaac
gtgaatgcgggcaccatgcagcacgcgctggcgcgccacgccaccaccatcctcgatttt
tacctcgacgaagcgcacgcgctgggcgcggaattgtccgtctcgaccctgatggtgggc
gtcagcgccgaactgcaggcactggccgaccagtcgccagacgcctcgccgcaccgcagc
gacgaaccgtaccgccgcgccctgatcggcatctatgcgcgcctggccgccaccgcccgc
gccctgggcgccaccaacatcctgcgcaaggaagtcgggccagccgccgcctatccggac
gcggccgcatttgtcgccgacctgcgcaccatcgtcgcctcgctcgagtcgcaccacggc
gcggccctggtgcgtccgcgcctggccaccctggcgcgtgcggccgacatcttcggtttc
cacctggcgtcgctggacatgcgccagacgtccgacgtgcacgagcgcgtgctggccgac
ctgttcgcgcacagcggcgtggccgccgattacacggccctgtccgaagaagacaagcag
gcactgctgctgagcgaactggcccagccgcggctgctgtactcgccctatatcagctat
gccacggaaacggattccgagctggcgatcctgcgcgcggcgcgcgacatccgccagcgc
tacggcgcgcgggcgattcgcaactacatcatttcacacacggaaaccgtgtccgacctg
ctggaagtgttgctgctgcaaaaggaaacgggcttgctgcgcaccgactggcaagctggc
gagagcacgtgcgagctcatggtcatccccctgttcgaaacgatccccgacctgcagcgc
gcagccggcatcatgagccaggtcatggccttgcctttggtcaagcaattgatcgccaaa
cagggacagttgcaggaagtaatgctcggctattccgattcgaacaaggatggcggcttc
ctcacgtcgaactgggaactgtacaaggccgaactggcattggtggcggatttccggaag
gccggcgtcaagctgcgcctgttccatggccgtggcggcacggtcggcaggggcggcgga
cccagctacgaagccatcctggcccagccaccgggcaccgtcaacggccagatccgcctg
acggaacagggcgaaatcatcgcctcgaagttttccaacgcggaaatcggccggcgcaac
ctggaattgctggtcgccgccaccctggaagcgagcctggcgccacaggcggccaatccc
gcgcacgcaagcgaactggcgcagttcgaagccgtgatggctgaactgtcggacctggcc
taccacgcctaccgccacctcgtgtatgaaacgccgggatttacggagtatttcttctcg
gccacgccgattgcggaaatcgccgagctgaacctcggctcgcgccccgcctcgcgcaag
gccaaccagcgcatcgaagacttgcgcgccattccctggggcttttcctggggccagtgc
cgcttgctgctgccgggctggttcggtttcggcagcgccatcgaggcctggatcaaccag
gctgacggcgcgtcgaaagatgaaaaaatcgccaccctgcgcgccatgtacgccgaatgg
ccgttctttgccaccttgctgtcgaacatggacatggtgctggccaagacggacctggcg
attgcctcgcgctatgcggaactggtggcagaccaggacttgcgcgaacgcatctacaag
cgcatcacggacgagcatggcaacaccttgcgctgcctggagctcatcaccggcaacacg
gagcgcctggcgggcaatccgctgctggcccgctcgatccagaaccgcttcgcctatctc
gacccgctgaaccacttgcaggtggaattgatcaagcgcaaccgcgccctgtcggcggaa
agcaaaatcgacgaaagggtgcaccgcggcatccagttgtcgatcaacggcgtggcggcc
ggtctgcgcaacacgggctga

DBGET integrated database retrieval system