KEGG   Janthinobacterium svalbardensis: CNX70_21585Help
Entry
CNX70_21585       CDS       T05119                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00020  Citrate cycle (TCA cycle)
jsv00190  Oxidative phosphorylation
jsv00650  Butanoate metabolism
jsv01100  Metabolic pathways
jsv01110  Biosynthesis of secondary metabolites
jsv01120  Microbial metabolism in diverse environments
jsv01130  Biosynthesis of antibiotics
jsv01200  Carbon metabolism
Module
jsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jsv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNX70_21585 (sdhB)
   00650 Butanoate metabolism
    CNX70_21585 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CNX70_21585 (sdhB)
Enzymes [BR:jsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CNX70_21585 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CNX70_21585 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Fer4_7 Mei4 Fer4
Motif
Other DBs
NCBI-ProteinID: ATD62444
UniProt: A0A290WZY2
LinkDB All DBs
Position
complement(4858419..4859129)
Genome map
AA seq 236 aa AA seqDB search
MARTLKFKIYRYDPDQDAKPYMQDLSVELKDTDKMLLDALQRIKADVDDSLALRRSCREG
VCGSDAMNINGKNGLACTTNLNELSEPIVLRPLPGLPVIRDLIVDMTQFFKQYDSIKPFL
INDSIPPEKERLQSPEQREELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYRFI
ADSRDEATGARLDNLEDPYRLFRCHSIMNCVDVCPKGLNPNKAIGKIKELMVRRAI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcactctcaaattcaaaatctaccgctacgatcctgaccaggatgccaagccg
tacatgcaagacctgtcggtcgaactgaaagacaccgacaagatgctgctcgatgcactg
cagcgcatcaaggcggacgtcgatgactcgctggccctgcgccgctcgtgccgcgaaggc
gtgtgcggttcggacgcgatgaacatcaacggcaagaacggcctggcctgcaccaccaac
ctgaacgaactgtcggagcctatcgtgctgcgtccgttgccaggtttgccggtcatccgc
gatctgatcgtcgacatgacgcaatttttcaagcagtacgattcgatcaagccgttcctg
atcaacgattcgatcccgcctgaaaaagaacgcctgcagtcgccggaacagcgcgaagaa
ctcgatggcctgtacgagtgcatcctgtgcgcatgctgctccacgtcgtgcccgtcgttc
tggtggaatccggacaaattcgtcggtccggcaggcctgctgcaagcctaccgcttcatc
gccgattcgcgcgacgaagccaccggcgcgcgtctggacaacctggaagacccgtaccgc
ctgttccgctgccattcgatcatgaactgcgtcgacgtttgcccgaaaggcttgaacccg
aacaaggcgatcggcaagatcaaggaattgatggtccgccgcgcgatctga

DBGET integrated database retrieval system