KEGG   Janthinobacterium svalbardensis: CNX70_21590Help
Entry
CNX70_21590       CDS       T05119                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00020  Citrate cycle (TCA cycle)
jsv00190  Oxidative phosphorylation
jsv00650  Butanoate metabolism
jsv01100  Metabolic pathways
jsv01110  Biosynthesis of secondary metabolites
jsv01120  Microbial metabolism in diverse environments
jsv01130  Biosynthesis of antibiotics
jsv01200  Carbon metabolism
Module
jsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jsv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNX70_21590
   00650 Butanoate metabolism
    CNX70_21590
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CNX70_21590
Enzymes [BR:jsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CNX70_21590
    1.3.5.4  fumarate reductase (quinol)
     CNX70_21590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 FAD_binding_3 HI0933_like GIDA Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ATD62445
UniProt: A0A290WZX3
LinkDB All DBs
Position
complement(4859139..4860920)
Genome map
AA seq 593 aa AA seqDB search
MAAYKSAIPTRRFDAVIVGAGGSGMRASLQLAEAGLNVAVLSKVFPTRSHTVAAQGGIGA
SLGNMAEDNWFWHMFDTVKGGDYLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTAHFGEKPVQRACAAADRTGHALLHTLYQRNVRARTHFFVEWMAIDLIRDAEG
DVIGVVALEMETGECMILEAKTTVMATGGAGRIFAASTNAFINTGDGMGMAARAGLPLQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILINSEGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDHVMLDLRHIGADTIAKRLPSILEIGHKFANVDATKEPIPVVPTIHYQ
MGGIPTNIHGQVVTPTGPDNSAQVVNGLYAIGECACVSVHGANRLGTNSLLDLVVFGRAA
GNHIVNSGLKAKENKPLPADAAEFAMGRLARLENSTGTETVQGVANDIRATMQKYCGVFR
TDEMLNKGVEEIMKLDERRKHVSFKDKSMVFNTARVEALELDNLIETAKATIVSAAARKE
SRGAHAQDDYPQRDDDNWMKHTLWYSEGNRLAYKPVVTKPLTVDTFKPKPRTF
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcatataaatctgcaattcctacccgccgctttgatgcggtcatcgttggtgcc
ggcggttccggcatgcgcgcgtcgttgcaactggctgaagccggtctgaacgtcgctgtc
ctgtcgaaagttttcccgacccgctcgcacaccgtggcggcgcagggcggtatcggcgcg
tcgctcggcaacatggccgaagacaactggttctggcacatgttcgacaccgtcaagggc
ggcgactatctgggcgaccaggatgccatcgaattcatgtgccgcgaagcaccgaaggtc
gtgtacgaactggaacacttcggcatgccattcgaccgcaaccctgacggcaccatctat
cagcgtcccttcggcggccacacggcccacttcggcgaaaagccggtgcagcgcgcttgc
gcggcagctgaccgtaccggtcacgccctgttgcacacgctgtaccagcgcaacgtgcgt
gcgcgtacgcatttcttcgtcgaatggatggcaatcgacctgatccgtgacgccgaaggc
gacgtgatcggtgttgtagcgctggaaatggaaaccggcgaatgcatgatcctggaagca
aagacgacggtcatggcaacgggcggcgcaggccgcatcttcgccgcctcgacgaatgcc
ttcatcaacaccggcgacggcatgggcatggcggcacgcgccggcctgccgctgcaagac
atggaattctggcagttccacccgaccggcgtggccggcgcgggcgtcttgatcaccgaa
ggcgtgcgcggcgaaggcggcatcctgatcaatagcgaaggcgaacgcttcatggagcgc
tatgcgccgaccctgaaggatctggcgccgcgcgacttcgtctcgcgttcgatggaccag
gaaatcaaggaaggccgcggctgcggtccgaacaaggaccacgtgatgctggacctgcgc
catattggcgccgacaccatcgccaagcgcctgccgtcgatcctggaaatcggccacaag
ttcgccaacgtcgacgccaccaaggaaccgattcctgtcgtgccgacgattcactaccag
atgggcggcattccaacgaacatccacggccaggtcgtcaccccgaccggtccggataat
tcggcgcaagtcgtcaacggcctgtacgcgatcggcgaatgcgcctgcgtgtcggtgcac
ggcgccaaccgcctgggcacgaactcactgctcgacctggtggtcttcggccgcgcggcc
ggcaaccacatcgtcaacagtggcctgaaagccaaggaaaacaagcctttgccagccgat
gctgccgaatttgccatgggccgcctggcgcgcctggaaaactcgaccggcacggaaacc
gtgcagggcgtggcgaacgacatccgcgcaacgatgcagaagtactgcggcgtgttccgt
acggacgagatgctgaacaagggcgtcgaagaaatcatgaagctcgacgagcgccgcaag
cacgtctccttcaaggataaatcgatggtcttcaacacggcccgcgtggaagcgctggaa
ctggacaatctgatcgaaacggcgaaagcgaccatcgtttcggcagcagcccgcaaggaa
tcgcgcggcgcccacgcccaggacgactatccacagcgtgacgacgacaactggatgaag
cacactctgtggtattcggaaggcaaccgactggcatacaagccagtcgtgaccaagccg
ctgacggttgataccttcaaaccgaaaccacgtactttctaa

DBGET integrated database retrieval system