KEGG   Janthinobacterium svalbardensis: CNX70_22490Help
Entry
CNX70_22490       CDS       T05119                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv03030  DNA replication
jsv03410  Base excision repair
jsv03420  Nucleotide excision repair
jsv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CNX70_22490
   03410 Base excision repair
    CNX70_22490
   03420 Nucleotide excision repair
    CNX70_22490
   03430 Mismatch repair
    CNX70_22490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:jsv03032]
    CNX70_22490
   03400 DNA repair and recombination proteins [BR:jsv03400]
    CNX70_22490
Enzymes [BR:jsv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNX70_22490
    6.5.1.6  DNA ligase (ATP or NAD+)
     CNX70_22490
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CNX70_22490
DNA replication proteins [BR:jsv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CNX70_22490
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CNX70_22490
DNA repair and recombination proteins [BR:jsv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CNX70_22490
   NER (nucleotide excision repair)
    Other NER factors
     CNX70_22490
   MMR (mismatch exicision repair)
    Other MMR factors
     CNX70_22490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ATD62605
UniProt: A0A290X0D5
LinkDB All DBs
Position
complement(5051127..5052758)
Genome map
AA seq 543 aa AA seqDB search
MRDFARLYAELDETTSTSRKLAALQAYFGAAAPENAAWAVYFLAGGKPRQAVPTRLLRAY
ATERAGLDAWLFDEAYHAVGDLAETIALILPAPSRRSDIGLAEWIEQRIAPLRGAAPDTI
RADLLAYWDELETRERFLLIKLIGGGFRVGVSKLLVTRALASIAAVDGKLIAQRLMGWTD
GKVSPTGAGFLKLIAAQSEGEHALRGGQPYPFFLAHPLQAGPETLGDIGDWLVEWKYDGM
RAQLLRREGVNWLWSRGEELITERFPELAQLALPEGTVLDGEILIWQPGDVPAPFADLQQ
RMGRKTVSSKLLAELPAVLVAYDVLETGGVDVRQLPQLERRALLESVVAQVDAPALRLSP
RIMAASWEALAAIRAESRARGVEGLMLKAVSAAYGVGRTKDVGTWWKWKIAPYAIDAVLI
YAQAGHGRRASLYTDYTFAVWDEEGGEERKLVPFAKAYSGLTDAEIAQVDAAIRKTTIEK
FGPVRSVQPTMVFEIGFEGIAASSRHKAGIAVRFPRILRRRDDKAIADADTLATLKAMLV
QAT
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgactttgcccgcttgtacgcggaactcgatgaaaccacgtccaccagccgcaag
ctggcggcgctgcaagcctattttggtgctgccgcgcccgagaacgcggcctgggccgtg
tacttcctggccggtggcaagccgcgccaggccgtgcccaccaggttgctgcgcgcatac
gcgaccgaacgggcaggcctcgatgcctggctgttcgacgaagcctatcacgccgtcggc
gacctggccgaaaccatcgccctgatcctgcccgcaccatccagacgcagcgacatcggc
ctggccgagtggatagagcagcgcatcgcaccgttgcgcggcgcagcgcccgacacgatt
cgcgccgacttgctggcctactgggatgagctggaaacgcgcgaacgttttttattgatc
aaactgatcggcggcggttttcgcgtgggcgtctcaaaactgctggtgacgcgcgcgctg
gcgtccatcgccgccgtcgacggcaagctgatcgcccagcgcctgatgggctggaccgat
ggcaaggtcagccccacgggggcgggatttttgaaactgatcgccgcgcagtcggagggc
gagcatgcgctgcgcggcggccagccttacccctttttcctggcgcaccccttgcaggcg
gggccggagacgctgggcgacatcggcgactggctggtcgaatggaagtacgacggcatg
cgtgcccagctgctgcgccgcgagggcgtgaactggctgtggtcgcgcggcgaggaattg
atcacggagcgctttcccgaattggcgcagctggccttgcccgagggcaccgtgctcgat
ggcgaaatcctcatctggcagcctggtgacgtgccagcgccatttgccgatttgcaacaa
cgcatgggccgcaagacggtgtcgtccaagctgctggccgagttgcccgccgtgctggta
gcctacgatgtgctggaaacgggtggcgtggatgtgcgccagttgccccagctcgaacgg
cgcgcgctgctggaaagcgtcgtggcgcaggtagatgctcccgcgctgcgcctgtcgccg
cgcatcatggctgccagctgggaggcgctggcggccatccgcgctgaatcgcgcgcgcgc
ggcgtggaaggcctgatgctcaaggccgtctcggccgcatatggcgtgggccgcacgaaa
gacgtgggcacgtggtggaaatggaagatagcgccgtatgccatcgacgccgtgctgatc
tacgcccaggcgggccacggccggcgcgcgtcgctgtacacggattacacgttcgccgta
tgggatgaggaaggtggcgaggagcgcaagctggtgccgttcgccaaggcgtattcgggc
ttgacggatgcggagatcgcgcaagtcgacgcggccatccgcaagacgacgatagaaaaa
ttcggccccgtgcgcagcgtgcagccaacgatggtattcgagatcggcttcgaaggcatc
gccgcgtccagccgtcacaaggcgggcatcgccgtgcgctttccccgcatcctgcgccgc
cgtgacgacaaggccatcgccgacgcggacaccctggccaccctgaaggccatgctggtc
caggccacatga

DBGET integrated database retrieval system