KEGG   Janthinobacterium svalbardensis: CNX70_27745Help
Entry
CNX70_27745       CDS       T05119                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00010  Glycolysis / Gluconeogenesis
jsv00620  Pyruvate metabolism
jsv01100  Metabolic pathways
jsv01110  Biosynthesis of secondary metabolites
jsv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNX70_27745
   00620 Pyruvate metabolism
    CNX70_27745
Enzymes [BR:jsv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CNX70_27745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ATD63523
UniProt: A0A290X338
LinkDB All DBs
Position
complement(6234034..6235554)
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLGVANPFKQRYDNYIGGKFVAPVKGEYFPNITPITGLPFCEIARSTAEDVEL
ALDAAHAAKDAWGKTSPAERANILNRIADRIEQNLSLIATAETIDNGKPIRETMNADIPL
AIDHFRYFAGCIRAQEGSVAQIDAETYAYHYHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVLIELIGDLLPPGVLNIINGFGLEAGKPLASSKRIAKIAFTG
ETGTGRLIMGYAAQNLIPVTLELGGKSPNIFFEDVMDADDDYFDKCLEGFTMFALNQGEV
CTCPSRVLIQESIYEKFIERALKRVAAIKQGNPLDASTMIGAQASQEQLEKILSYLDIGR
QEGAEVLAGGERHTQAGDLEGGYYVRPTVFKGNNKMRIFQEEIFGPVVSVTTFKDEAEAL
AIANDTLYGLGAGLWTRDGSRAFRMGRAIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgcagacatcagcaaactgggcgtagccaatcccttcaaacaacgctatgac
aattacatcggcggcaaattcgttgcaccagtaaaaggtgaatactttcctaacatcacg
cccatcacgggcttgccgttttgcgaaatcgcccgttccacggcggaagatgtcgagttg
gcgctggacgccgcgcatgccgccaaggatgcctggggcaagacttcacctgccgagcgc
gccaatatcctgaaccgcatcgccgaccgcatcgaacagaacctgagcctgatcgccacg
gcggaaaccatcgacaacggcaagccgatccgtgaaacgatgaatgccgacattccgctg
gccatcgaccatttccgttacttcgccggctgcatccgcgcgcaggaaggttccgtcgcg
caaatcgacgcggaaacctatgcctatcactaccatgagccgctgggtgtcgtgggccag
atcattccgtggaatttcccgattctgatggccgtctggaaactggcgccagccctggcc
gccggcaattgcgtggtcttgaaaccggccgagcagacccccgcctccatcatggtgttg
atcgagctgatcggcgacttgctgccaccgggcgtgttgaacatcatcaacggtttcggc
ctggaagcgggcaagccgttggcgtcgagcaagcgcatcgccaagatcgcctttacgggt
gaaacgggcacgggccgcctgatcatggggtatgccgcgcaaaacctgattcccgtcacc
ctggagctgggcggcaagtcgccaaacatcttctttgaagatgtgatggatgccgatgat
gattatttcgacaagtgcctggaaggcttcaccatgtttgcgctgaaccagggcgaggtg
tgcacctgcccatcgcgcgtgctgatccaggaatcgatttacgagaaattcatcgaacgg
gccttgaagcgcgtggccgccatcaagcagggcaatccgctcgatgccagcaccatgatc
ggcgcccaggcgtcgcaggagcagctggaaaaaatcctgtcctacctcgacatcggccgc
caggaaggcgcagaagtgctggccggcggcgagcgccatacgcaggcaggcgacctggag
ggcggttactacgtgcgtccgacggtgttcaagggcaacaacaagatgcgcatcttccag
gaagagattttcgggcccgtcgtgtccgtgaccaccttcaaggatgaggccgaagcgctg
gcgattgccaacgataccttgtacggcctgggtgccggcttgtggacgcgtgacggttcg
cgcgccttccgcatgggacgcgccatccaggcgggccgcgtgtggaccaattgctaccac
ctgtatccagcccacgccgctttcggcggttacaagcaatcgggtatcggccgtgaaaac
cacaagatgatgctcgaccactatcagcaaacgaagaacttgctggtgagctatagcccg
aaagccctgggcttcttctaa

DBGET integrated database retrieval system