KEGG   Janibacter indicus: ASJ30_12060Help
Entry
ASJ30_12060       CDS       T04569                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
jte  Janibacter indicus
Pathway
jte00473  D-Alanine metabolism
jte01100  Metabolic pathways
jte01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:jte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ASJ30_12060
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ASJ30_12060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jte01011]
    ASJ30_12060
Enzymes [BR:jte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ASJ30_12060
Peptidoglycan biosynthesis and degradation proteins [BR:jte01011]
 Precursor biosynthesis
  Racemase
   ASJ30_12060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PE
Motif
Other DBs
NCBI-ProteinID: APH03178
UniProt: A0A1L3MLG2
LinkDB All DBs
Position
complement(2518328..2519482)
Genome map
AA seq 384 aa AA seqDB search
MPSDAPTDGLSAWADIDLDAIRDNVARLGELAGDADVMAVIKGDAYGHGLVPVAGAALAG
GATYLGIAQLGEAMAARVAGVTAPILTWLFPPGADLVSAVRADLTLSAGAPWALAEIAAA
ARATGQTARVHLKVDTGLGRGGAWRDDLAGMLVDAARLEAEGVLDVEGIFSHFVYADAPD
HPTVRAQQETFGAILEDAERAGLHPRIRHLANSAATLTNPSARFDMVRPGVSIYGLSPVP
DIGGPPHFGLREAMRVVARLINVKDCPAGQGVSYGHQYTTKGDTRLGLVPLGYADGIPRH
ASGVGPMQVHGRRYTVAGRVCMDQMVLDLGADSPAVAGDEVVLIGREADGEPTAQDWAAA
IDTINYEIVTRLGPRVPRRYLGGQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ctgccgagcgatgcgccgaccgacggtctgtccgcatgggcggacatcgacctcgacgcg
atccgcgacaacgtcgcccgcctcggcgagctcgccggtgacgccgacgtcatggcggtc
atcaagggtgatgcctacggccacggcctcgtcccagtcgccggcgccgccctggccggc
ggcgccacctacctgggcatcgcccagctcggcgaggcgatggcggcccgcgtcgcgggc
gtcaccgcgccgatcctcacctggctcttcccgcccggggccgacctcgtctctgcggtg
cgcgccgacctcaccctctcggccggtgccccgtgggcgctcgccgagatcgccgcggcg
gcccgggccaccgggcagaccgcccgcgtccacctcaaggtcgacaccggcctggggcgc
gggggtgcgtggcgcgacgacctcgccggcatgctcgtggacgccgcccggctcgaggcc
gagggcgtgctggacgtcgagggcatcttcagccacttcgtctatgccgacgctcccgac
cacccgacggtgcgggcccagcaggagaccttcggcgcgatcctcgaggacgccgagcgt
gccggtctgcacccgcgcatccgccacctcgccaactccgcggcgaccctgaccaacccc
tcggcgcgattcgacatggtccgccccggggtctcgatctacgggctgtcgccggtgccc
gacatcggtgggcccccccacttcggcctgcgcgaggccatgcgcgtcgtcgcccgcctc
atcaacgtcaaggactgcccggccggccagggtgtctcctacggccaccagtacacgacg
aagggggacacccgcctcggcctcgtgccgctcggctatgccgacggcatcccccggcac
gcctcgggtgtcggcccgatgcaggtccacggccgccgctacaccgtcgcgggacgggtg
tgcatggaccagatggtgctcgacctgggtgccgacagccccgccgtggccggcgacgag
gtcgtcctcatcggccgcgaggccgacggcgagccgaccgcccaggactgggcggccgcg
atcgacacgatcaactacgagatcgtcacccggctcgggccccgcgtcccgcgccgctac
ctcggaggccagtga

DBGET integrated database retrieval system