KEGG   Janibacter indicus: ASJ30_12690Help
Entry
ASJ30_12690       CDS       T04569                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
jte  Janibacter indicus
Pathway
jte03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:jte00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ASJ30_12690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:jte03400]
    ASJ30_12690
Enzymes [BR:jte01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ASJ30_12690
DNA repair and recombination proteins [BR:jte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ASJ30_12690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: APH03190
UniProt: A0A1L3MLK8
LinkDB All DBs
Position
2642993..2643928
Genome map
AA seq 311 aa AA seqDB search
MRPMLATLAEAVPRGPDWVHEIKWDGMRVLADVRGGGLTLTSRSGRDVTVSFPELVPLAD
LFDDMLLDGEVVSLVDGRPSFGALAERMHIGDARRAARAAVAHPVTFVVFDVVRLLGQDL
AGQPWSARRALLEQLELDGPRVQVPPVHDDGEGLLAATAEQGLEGIVSKRRSSTYAPGRR
SPDWLKLPHRDGISVVVGGWRPEVGGSRLGAVLVGLPGPTGWEFVGRVGSGLAGRAGAGL
LARLRPLEVTGSPFVGEVPREDATGTTWVEPQVVIDVASLGRSSGGRLRQPSFQRVRTDL
TATDLQETSDG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgatgctcgccaccctcgccgaggccgtcccgcgcggccccgactgggtgcac
gagatcaagtgggacggcatgcgggtgctcgccgacgtacgcgggggcggactgacgctc
acgagccggtcgggccgagacgtcacggtctccttccccgagctcgtcccgctcgccgac
ctcttcgacgacatgctcctcgacggcgaggtggtctccctcgtcgacggacgaccgagc
ttcggcgcgctcgccgagcggatgcacatcggcgacgcccgccgcgctgcccgggctgcg
gtcgcccacccggtgaccttcgtcgtcttcgacgtcgtgcggctgctcggccaggacctc
gccggccagccgtggtcggcccgccgagccctcctcgagcagctcgagctcgacggcccg
cgcgtgcaggtcccaccggtccacgacgacggcgaggggctgctcgcggcgaccgccgag
caggggctcgagggcatcgtctccaagcgacgcagctcgacctatgctcccggccgccgc
tcccccgactggctcaagctcccccaccgcgacggcatctcggtcgtcgtcggtgggtgg
cgtcccgaggtcggcggctcacggctcggcgccgtgctcgtcggcctgccgggccccacg
gggtgggagttcgtcgggcgggtcggctccgggctcgccggccgggccggcgccggcctc
ctggcacggctgcgaccgctcgaggtgacggggtcccccttcgtcggtgaggtgccgcgc
gaggacgcgaccggcacgacctgggtggagccacaggtcgtcatcgacgtcgcgagcctg
ggccgcagctccgggggccggctgcggcagccctccttccagcgggtgcgcaccgacctg
accgccaccgacctgcaggagacgagcgatggctga

DBGET integrated database retrieval system