KEGG   Janibacter indicus: ASJ30_13710Help
Entry
ASJ30_13710       CDS       T04569                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
jte  Janibacter indicus
Pathway
jte00220  Arginine biosynthesis
jte00250  Alanine, aspartate and glutamate metabolism
jte00290  Valine, leucine and isoleucine biosynthesis
jte01100  Metabolic pathways
jte01110  Biosynthesis of secondary metabolites
jte01130  Biosynthesis of antibiotics
jte01210  2-Oxocarboxylic acid metabolism
jte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:jte00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASJ30_13710
   00290 Valine, leucine and isoleucine biosynthesis
    ASJ30_13710
   00220 Arginine biosynthesis
    ASJ30_13710
Enzymes [BR:jte01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ASJ30_13710
    2.6.1.66  valine---pyruvate transaminase
     ASJ30_13710
Amino acid related enzymes [BR:jte01007]
 Aminotransferase (transaminase)
  Class I
   ASJ30_13710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: APH02457
UniProt: A0A1L3MJB0
LinkDB All DBs
Position
2845319..2846536
Genome map
AA seq 405 aa AA seqDB search
MRQIRQSRKLKDVRYDVRGPILVEAQRLEAEGHKILKLNIGNTAPFGFEAPEAIVADMTR
HLPDAQGYVDSKGIYSARTAVAQYYQSRGLRDTSVEDVYIGNGVSELISMVLQAFVDDGN
EILVPAPDYPLWTGAVSLAGGTPVHYRCDEDNGWNPDLADIESKITEHTQALVIINPNNP
TGAVYSPEIVRGLVDIARRHDLVVMADEIYEKIVFDDAVHHHAAEYAGDDVLCLTFSGLS
KAYRVCGYRAGWVMISGPKHEAADFLEGLTLLANMRMCANVPAQHAIQTALGGYQSINEL
IVPGGRYHDQIKLASRLLNEIPGVSCVEPRGALYCFPRLDPEVYPIEDDEAFVIDLLRAK
KILVTHGTGFNWPDTDHFRLVTLPDEDVLTEAIGRIAEYLESIRA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagatccgccagagccgcaagctgaaggacgtccggtacgacgtgcgggggccg
atcctcgtcgaggcccagcgcctcgaggccgagggccacaagatcctcaagctcaacatc
ggcaacaccgcccccttcggcttcgaggcacccgaggcgatcgtcgcggacatgacccgg
cacctgccggacgcgcagggctacgtcgacagcaagggcatctactcggcccgcacggcc
gtcgcgcagtactaccagtcccgtggcctgagggacacgagcgtcgaggacgtctacatc
ggcaacggcgtctccgagctgatctcgatggtgctgcaggccttcgtcgacgacggcaac
gagatcctcgtgcccgcccccgactacccgctgtggaccggagcggtctcgctcgccggc
ggcacacccgtgcactaccggtgcgacgaggacaacgggtggaaccccgacctcgcggac
atcgagtcgaagatcaccgagcacacccaggcgctcgtcatcatcaaccccaacaacccg
accggcgcggtctactcgcccgagatcgtccgcggcctcgtcgacatcgcccgtcgccac
gacctcgtcgtcatggccgacgagatctacgaaaagatcgtcttcgacgacgcggtccac
caccacgcggccgagtacgcgggcgacgacgtgctctgcctgaccttctccggcctgtcc
aaggcctaccgggtctgcggctaccgcgccggctgggtgatgatctccgggcccaagcac
gaggcggccgacttcctcgagggcctgaccctcctggccaacatgcgcatgtgcgccaac
gtccccgcccagcacgcgatccagaccgcgctcggcggataccagtcgatcaacgagctc
atcgtccccggcggtcgctaccacgaccagatcaagctcgcctcgcgcctgctcaacgag
atccccggcgtcagctgcgtcgagccgcgcggggcgctctactgcttcccgcgactcgac
cccgaggtctacccgatcgaggacgacgaggccttcgtcatcgacctgctgcgcgccaag
aagatcctcgtcacccacggcaccggcttcaactggcccgacaccgaccacttccgcctc
gtgacgctgcccgacgaggacgtgctcaccgaggcgatcggccggatcgcggagtacctc
gagtcgatccgcgcatga

DBGET integrated database retrieval system