KEGG   Janibacter indicus: ASJ30_14995Help
Entry
ASJ30_14995       CDS       T04569                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jte  Janibacter indicus
Brite
KEGG Orthology (KO) [BR:jte00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASJ30_14995
Enzymes [BR:jte01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ASJ30_14995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA FAD_binding_2 FAD_oxidored Thioredoxin_3 HI0933_like FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase DAO FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APH02687
UniProt: A0A1L3MJZ5
LinkDB All DBs
Position
complement(3124217..3125896)
Genome map
AA seq 559 aa AA seqDB search
MALDPNLATQLKAYLDNLREPIELVASLDEGPKSRELDELLVEIEGMSELITRRVVEADE
LDERVPSFAITRTSDPQVWVRFAGIPMGHEFTSLVLALLQVGGHPSKASQDLIEQVKGLT
GQHHFETFFSLSCQNCPDVVQALNLMSVLNPGITHTAIDGAVFPTEAEQRGVLAVPTVFR
NGESFGSGRMELAEIVGKVDELSGGDSAAKAAEELSAREPYDVLVVGGGPAGASAAIYAA
RKGIRTGLVAERFGGQVLDTMAIENLVSVPHTEGPKLAADLERHVGEYDVDMIRSQAAAG
LSAGDDGLTVVDLVGGAALKGKTVVLATGARWRTMGVPGEEDYRNKGVTFCPHCDGPLFK
GKRIAVIGGGNSGVEAAIDLAGIVGHVTLVEFMDEMRADEVLQRKLRSLPNVDIRLGTKT
TEVVGDGGKVTGIVVEPRDGGEGETLALEGVFVQIGLLPNTEWLGDAVELSERGEIVIDG
VGRTNLPGVFAAGDCTVEPYKQIVTALGAGSTASLSAFDHLIRTSAPDEDAAIAATKAAD
GPLEAGDQIDVPDSVGVSA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgatccaaacctcgccacccagctcaaggcctacctcgacaacctccgcgag
ccgatcgagctcgtcgcgagcctcgacgagggccccaagtcccgtgagctcgacgagctg
ctcgtcgagatcgagggcatgagcgagctgatcacccgacgcgtcgtcgaggctgacgag
ctcgacgagcgggtcccctccttcgcgatcacccggacctccgacccgcaggtgtgggtg
cgcttcgccggcatcccgatgggccacgagttcacctccctcgtcctggccctgctgcag
gtcggcggccaccccagcaaggcgtcgcaggacctcatcgagcaggtcaagggcctcacc
gggcagcaccacttcgagaccttcttctcgctcagctgccagaactgccccgacgtcgtc
caggcgctcaacctcatgagcgtgctcaaccccggcatcacgcacaccgccatcgacggc
gccgtcttcccgaccgaggccgagcagcgtggcgtgctcgcggtgcccaccgtcttccgc
aacggcgagtccttcggctccggccgcatggagctggccgagatcgtcggcaaggtcgac
gagctctccggtggtgactccgccgccaaggcggccgaggagctctccgcgcgcgagccc
tacgacgtcctcgtcgtcggtggcggacccgccggtgcctccgccgcgatctacgccgcg
cgcaagggcatccgcaccggtctcgtcgccgagcgcttcggcggtcaggtgctcgacacc
atggcgatcgagaacctcgtctccgtcccgcacaccgagggcccgaagctcgcggccgac
ctcgagcgccacgtcggcgagtacgacgtcgacatgatccgcagccaggccgccgccggc
ctctccgccggcgacgacgggctgaccgtcgtcgacctcgtgggcggcgccgcgctcaag
ggcaagaccgtcgtcctcgcgacgggcgcccgctggcgcaccatgggcgtccccggcgag
gaggactaccgcaacaagggcgtcaccttctgcccgcactgcgacggcccgctcttcaag
ggcaagcgcatcgccgtcatcggcggcggcaactccggcgtcgaggccgcgatcgacctc
gcgggcatcgtcgggcacgtcaccctcgtcgagttcatggacgagatgcgcgccgacgag
gtgctccagcgcaagctgcgctcgctgcccaatgtcgacatccgcctcggcaccaagacg
accgaggtcgtcggcgacggcggcaaggtcaccggcatcgtcgtcgagccccgtgacggc
ggcgagggcgagaccctcgccctggagggtgtcttcgtccagatcggcctgctgcccaac
accgagtggctcggtgacgcggtcgagctctccgagcgcggcgagatcgtcatcgacggt
gtcggccggaccaacctgccgggcgtcttcgccgccggcgactgcacggtcgagccctac
aagcagatcgtcacggccctgggtgccgggtcgaccgcgtccctgagcgccttcgaccac
ctgatccgcacgagcgcgcccgacgaggacgccgcgatcgccgccaccaaggctgccgac
ggtccgctcgaggccggcgaccagatcgacgtgcccgactcggtgggcgtctcggcctga

DBGET integrated database retrieval system