KEGG   Janibacter indicus: ASJ30_15230Help
Entry
ASJ30_15230       CDS       T04569                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
jte  Janibacter indicus
Pathway
jte00250  Alanine, aspartate and glutamate metabolism
jte00410  beta-Alanine metabolism
jte00640  Propanoate metabolism
jte00650  Butanoate metabolism
jte01100  Metabolic pathways
jte01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ASJ30_15230
   00650 Butanoate metabolism
    ASJ30_15230
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASJ30_15230
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASJ30_15230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jte01007]
    ASJ30_15230
Enzymes [BR:jte01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ASJ30_15230
Amino acid related enzymes [BR:jte01007]
 Aminotransferase (transaminase)
  Class III
   ASJ30_15230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APH02727
UniProt: A0A1L3MK36
LinkDB All DBs
Position
3168255..3169496
Genome map
AA seq 413 aa AA seqDB search
MTALSPLLKQATPVTIDHALGTEIFDVDGNRHLDFTAGIGVVSTGHCHPKVVAAAQEQVG
KLIHGQYTTVMHQPLLALVDKLQGVLPSHLDSLFFANSGSEALEASLRLSRQATGRPNVI
VFHGGFHGRTVATATMTTSGTRFSAGFSPLMGGVHVAPFPTAYRYGWSEEEATAFALKEL
DYILATLTSPQETAAFIVEPVLGEGGYIPGNTAFFQGLRERADRHGILLVMDEVQTGFGR
TGKMFGHEHFDVQPDIITLAKGIASGFPISGIAASEELMSKAWPGSQGGTYGGNAVACAA
AVATLEVIEEEGLVANSAERGTQLLEGTKAAAVDGIGDVRGLGLLVGSEFTAADGTPDTA
RAQAAQQLAAKKGLLLLTCGAHMNVVRMIPPLVVTAEQVDEALEIWGKVLAEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgctgtcccccctgctgaagcaggccacccccgtgacgatcgaccacgccctc
ggcaccgagatcttcgacgtcgacggcaaccgccacctcgacttcaccgccggcatcggt
gtcgtgagcaccgggcactgccaccccaaggtcgtcgccgccgcgcaggagcaggtcggc
aagctcatccacggccagtacacgacggtcatgcaccagccgctgctcgccctcgtcgac
aagctgcagggtgtgctcccttcgcacctcgacagcctcttcttcgccaactccggcagc
gaggcgctcgaggcctccctgcgcctctcgcgccaggcgaccggccggcccaatgtcatc
gtcttccacggcggcttccacggccgcaccgtcgcgacggcgacgatgacgacctccggc
acccgcttctcggccggcttctccccgctcatgggcggggtgcacgtcgcccccttcccc
accgcctaccgctacggctggagcgaggaggaggccaccgccttcgccctcaaggagctc
gactacatcctcgcgacgctcacctcgccgcaggagaccgcggccttcatcgtcgagccg
gtcctcggcgaagggggctacatccccggcaacaccgccttcttccaggggctgcgcgag
cgggccgacaggcacgggatcctcctcgtcatggacgaggtccagaccggcttcggccgc
accggcaagatgttcggccacgagcacttcgacgtgcagcccgacatcatcaccctggcg
aaggggatcgcctccggcttcccgatctccggtatcgccgcgagcgaggagctgatgagc
aaggcgtggccgggctcgcagggtggcacctacggcggcaatgccgtcgcgtgcgccgcg
gccgtcgccaccctcgaggtcatcgaggaggagggcctggtcgccaactccgccgagcgc
ggcacccagctgctcgagggcacgaaggccgccgccgtcgacgggatcggcgacgtgcgc
ggcctcggcctgctcgtcggcagcgagttcaccgccgccgacggcacgcccgacaccgcc
cgcgcccaggcggcccagcagctggccgccaagaagggcctgctgctgctcacctgcggc
gcccacatgaacgtcgtgcggatgatcccgccgctcgtcgtcaccgccgagcaggtcgac
gaggccctggagatctggggcaaggtcctggcggaggtctga

DBGET integrated database retrieval system