KEGG   Kitasatospora albolonga: B7C62_01000Help
Entry
B7C62_01000       CDS       T05009                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
kab  Kitasatospora albolonga
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PglD_N
Motif
Other DBs
NCBI-ProteinID: ARF70987
UniProt: A0A1V0V0M2
LinkDB All DBs
Position
complement(241747..242736)
Genome map
AA seq 329 aa AA seqDB search
MRAAIVEAPGKVSVTTVDDPTPGRRDVVVKVASCGLCGTDLHILQGEFAPTLPIVPGHEF
AGEIVAVGTDVTELAVGDKVAVDPSLHCHECRYCRSGRGNLCDNWAAIGVTVPGGAAEFA
VAPVANCVKLPDHIDVTDAALIEPLSCAVRGYDVLKGNLGAEVLIYGSGTMGLMMLELAK
RTGAASVEVLDVNPQRLETATLLGCTGAAARAEELDRPGGWDVVIDATGNAAAIQDGLGR
VAKGGTFLQFGVADYATTAVIEPYRIYNQEITITGSMAVLHSYERAAALFASGVLDPAVF
ISDRLPLERYPEAIDQFKAGVGRKIVVQP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagccatcgtcgaggcccccggcaaggtctcggtcaccacggtcgacgacccc
acgcccggccgccgtgacgtggtcgtgaaggtggcgtcctgcgggctctgcggcaccgat
ctccacattctccagggggagttcgcccccaccctgccgatcgtgcccggccatgagttc
gccggggagatcgtcgccgtcggcaccgacgtcaccgaactggccgtcggggacaaggtg
gccgtcgacccctcgctccactgccacgagtgccgctactgccgctccggccgcggcaac
ctctgcgacaactgggccgccatcggcgtcaccgtccccgggggcgccgccgagttcgcc
gtcgccccggtcgccaactgcgtcaagctgcccgaccacatcgacgtcaccgacgcggcc
ctcatcgagccgctctcctgcgcggtgcgcgggtacgacgtcctgaagggcaacctgggc
gccgaggtgctgatctacggctccggcacgatgggcctgatgatgctggagctggccaag
cgcacgggcgccgcgtcggtggaggtcctggacgtcaacccgcagcggctggagacggcg
acgctcctgggctgcacgggggcggcggcccgcgccgaggagctcgaccggccgggcggc
tgggacgtggtcatcgacgccaccggcaacgcggcggcgatccaggacggcctgggccgg
gtcgccaagggcggcacgttcctccagttcggagtggccgactacgccacgaccgccgtc
atcgagccgtaccggatctacaaccaggagatcaccatcaccggctcgatggcggtcctg
cacagctacgagcgggccgccgcgctcttcgcgagcggggtgctggacccggccgtcttc
atcagcgaccggctgccgctggagcggtacccggaggcgatcgaccagttcaaggcgggg
gtggggcggaagatcgtggtgcagccgtag

DBGET integrated database retrieval system