KEGG   Kitasatospora albolonga: B7C62_05270Help
Entry
B7C62_05270       CDS       T05009                                 

Definition
(GenBank) DNA mismatch repair protein MutT
Organism
kab  Kitasatospora albolonga
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: ARF71728
UniProt: A0A1V0V3F2
LinkDB All DBs
Position
1232201..1232680
Genome map
AA seq 159 aa AA seqDB search
MINTSVMNSRNAVCVIVHDKAAGTIAAVLYTARSWSPQPAWAFPGGKAEPGESLDEAAAR
ELKEETGLLVDPADLVLVHVIHVEQGWDQAGQFVLFVFATDTWAGELTNAEPDKHLTAEW
VDESRLPTPTLPTSTQALVAYRDGGPSFSLYGWSATSVQ
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacaccagcgtgatgaacagccgcaacgcagtctgcgtaatcgtccatgacaag
gccgccggcacgatcgccgccgtgctctacaccgcccgcagctggtcaccgcaaccggcc
tgggccttccccggcggcaaggccgaacccggtgagtccctcgatgaggccgccgcccgc
gaactcaaggaggagaccggccttcttgtcgacccggcggatctcgtcctcgtccacgtc
atccacgtcgaacagggctgggaccaggccgggcagttcgtcctgttcgtcttcgccacc
gacacgtgggccggtgagctgaccaacgcagagccggacaagcacctgacggccgagtgg
gttgacgagagccgcctgcccacgcccacgctcccaacctccacgcaggccctggtggcg
tatcgggacggaggtccttccttctccctctacgggtggtcggccaccagtgtgcagtaa

DBGET integrated database retrieval system