KEGG   Kitasatospora albolonga: B7C62_08470Help
Entry
B7C62_08470       CDS       T05009                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
kab  Kitasatospora albolonga
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARF72304
UniProt: A0A1V0V4B2
LinkDB All DBs
Position
complement(1954413..1955873)
Genome map
AA seq 486 aa AA seqDB search
MTELVEHGHLFIGGEFTDPLGTDVIEVISPHTEQVIGRVPHASEADVDRAVAGARRAFDE
GPWPRMSLDERIAVITRIKDAFAVRHEEFARLISAQNGTPYSASVMVQALAAMMVWDSAI
TVARTFPYEERRDGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCTAVLKV
SPETPLDAYLLAEITAEAGLPPGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGRRVM
EVASRNLTRVTLELGGKSAAVILPDADLEAAVAGIVPFAWMINGQACVAQTRILAPRSRY
DEMAEAFAAAAGALRVGDPLDPTTELGPLVARRQQQRSLDYIRLGQEEGAKILTGGSRPA
SQERGWYVEPTLFGSVDNSMRIAREEIFGPVICLIPYADEAEAVRIADDSPYGLSGSVWT
ADTERGIDIARCIRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEFFEHKMIHLP
AGYRSA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcttgtggaacacggacacctgttcatcggcggggagttcaccgatccgctc
ggcaccgacgtcatcgaggtgatctccccgcacaccgaacaggtcatcggccgcgtcccg
cacgcttccgaggccgatgtggaccgagcggtcgccggggcccgccgagcctttgacgaa
ggcccctggccccggatgtcgctggacgagcggatcgcggtgatcacgcggatcaaggac
gcgttcgccgtacgccacgaggagttcgcgcgcctgatcagcgcgcagaacgggaccccg
tacagcgcgagcgtgatggtgcaggcgctggccgcgatgatggtctgggactcggcgatc
acggtggcgcgcacgttcccgtacgaggaacgccgcgacggagtcctcggcccgctcctg
gtccgccgggagccggtcggggtggtggcggcggtcgtcccgtggaacgtcccccagttc
acggccgccgccaagctggccccggcgctcctggcgggctgcaccgcggtcctgaaggtc
tccccggaaacccccctggacgcctacctcctggcggagatcacggcggaggcgggcctg
ccccccggggtcctctccatcctcccggccgaccgcgaggtcagcgagtacctggtgggc
cacccgggcgtggacaaggtctccttcacgggctcggtggccgccggccgccgcgtgatg
gaggtcgcctcccgcaacctcacccgcgtcacgctggagctgggcggcaagtcggcggcg
gtgatcctgccggacgcggacctggaggcggcggtcgcgggcatcgtccccttcgcctgg
atgatcaacggccaggcgtgcgtggcccagacccgcatcctggccccgcgctcccgctac
gacgaaatggcggaggcgttcgcggcggcggcgggagccctgcgcgtgggcgaccccctg
gacccgaccaccgaactgggcccgctggtggcccgacgccagcagcaacgctccctggac
tacatccgtctgggccaggaggaaggcgccaagatcctcaccggcggcagccgccccgcc
tcccaggagcgcggctggtacgtcgaacccaccctcttcggctcggtcgacaactccatg
cgcatcgcccgcgaggagatcttcggcccggtgatctgcctgatcccgtacgccgacgag
gccgaggccgtccgcatcgccgacgactccccgtacggcctcagcggcagcgtctggacg
gcggacacggaacgcggcatcgacatcgcccgctgcatccgcacgggcacgtacagcgtg
aacaccttcagcctcgacatgctcggcccgttcggcggctacaagaactccggcctgggc
cgcgagttcggccccgagggctacggcgagttcttcgagcacaagatgatccacctcccc
gccggctaccggagcgcctga

DBGET integrated database retrieval system