KEGG   Kitasatospora albolonga: B7C62_12650Help
Entry
B7C62_12650       CDS       T05009                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kab  Kitasatospora albolonga
Pathway
kab00620  Pyruvate metabolism
kab00680  Methane metabolism
kab01100  Metabolic pathways
kab01120  Microbial metabolism in diverse environments
kab01200  Carbon metabolism
Module
kab_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B7C62_12650
  09102 Energy metabolism
   00680 Methane metabolism
    B7C62_12650
Enzymes [BR:kab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B7C62_12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF615
Motif
Other DBs
NCBI-ProteinID: ARF73022
UniProt: A0A1V0V6B8
LinkDB All DBs
Position
complement(2942692..2945421)
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPAASTELRADIRRLGDLLGETLVRQEGQELLDLVERVRALTRTDGEAAAELLG
DTDLETAAQLVRAFSTYFHLANVTEQVHRAHEMRDRRSAEGGLLARTADRLKDADPEHLR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAELLETPVIEADRRRHDLRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHANAVGDVLEDLAAELERVGVELPAGTRPLTFGTW
IGGDRDGNPNVTPAVTWDVLILQHEHGITDALELIDYLRGLLSNSIRYTGATDELLTSLQ
ADLERLPEISPRYKRLNAEEPYRLKATCIRQKLVNTRERLAKGTPHRPGCDYLGTSELLA
DLALIQTSLREHRGGLFADGRMDRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTIKEAFERFGPEV
IESYIISMCQGADDVFAATVLAREAGLLDLHAGWAKIGIVPLLETTDELKAADVILDAML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDTVSDAAHSAYRKLVEDPDLPAYFLASTPVDQLADLH
LGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDTVLEEMH
EHWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDAIEAEHALTVSEVLKVTG
STELLGTSPALQQTFAIRDAYLDPISYLQVSLLARQRQAAERGEEPDPLLSRALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacccccgccgccagcaccgagctgcgcgccgacatccgccgc
ctcggcgacctcctcggcgaaaccctcgtacgccaggaaggccaggaactcctcgacctc
gtcgagcgggtacgcgccctgacccgcaccgacggcgaagcggccgccgaactcctcggc
gacacggacctggagaccgccgcacagctcgtgcgcgccttctccacctacttccacctc
gccaacgtcaccgagcaggtccaccgcgcccacgagatgcgcgaccgccgctccgccgag
ggcgggctcctggcccgcaccgccgaccggctcaaggacgccgaccccgagcacctgcgc
gagacggtcaagaacctcaacgtccggcccgtcttcaccgcccaccccaccgaggccgcc
cgccgctccgtcctcaacaagctccgccgcatcgccgagctgctggagaccccggtcatc
gaggccgaccgccgccgccacgacctccggctcgccgagaacatcgacctcatctggcag
accgacgaactccgcgtcgtccgcccggagcccgccgacgaggcccgcaacgccatctac
tacctcgacgagctccacgccaacgccgtcggcgacgtcctcgaggacctcgccgccgaa
ctggaacgcgtcggcgtcgaactccccgccgggacccgccccctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtgacccccgccgtcacctgggacgtcctc
atcctccagcacgaacacggcatcaccgacgccctcgaactcatcgactacctgcgcggc
ctgctctccaactccatccgctacaccggagccaccgacgagctcctcacctccctccag
gccgacctggaacgcctccccgagatcagcccccgctacaagcggctgaacgccgaggag
ccctaccgcctcaaggccacctgcatccgccagaagctcgtcaacacccgcgagcgcctc
gccaagggcaccccccaccgccccggctgcgactacctcggcacctccgagctcctcgcc
gacctggccctcatccagacctccctgcgcgaacaccgcggcggcctcttcgccgacggc
cgcatggaccgcaccatccgcaccctcgccgccttcggcctccagctcgccaccatggac
gtacgcgaacacgccgacgcccaccaccacgcgctcggccagctcttcgaccgcctcggc
gaggagtcctggcgctacgccgacatgccccgcgactaccggcagaagctcctcgccaag
gaactccgctcccgccggcccctcgcccccacccccgccccgctcgacgcggccggggag
aagaccctcggcgtcttccacaccatcaaggaagccttcgagcgcttcggccccgaagtc
atcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccaccgtc
ctcgcccgcgaggccggactcctcgacctccacgcgggctgggccaagatcggcatcgtc
cccctcctggagaccaccgacgagctcaaggccgccgacgtcatcctcgacgccatgctc
gccgacccctcctaccgccgcctcgtctccctccgcggcgacgtccaggaggtcatgctc
ggctacagcgactcctccaagttcggcggcatcaccaccagccagtgggagatccaccgc
gcccagcgccgcctccgcgacgtcgcccaccgctacggcgtacgcctgcgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatcctcgcccag
ccctggggcaccctggaaggcgagatcaaggtcaccgaacagggcgaggtcatctccgac
aagtacctcatccccgccctcgcccgcgagaacctggaactcaccgtcgcggccaccctc
caggcatccgccctccacaccgcaccccgccagtccgacgaggccctcgcccgctgggac
gcggccatggacaccgtctccgacgccgcccacagcgcctaccgcaagctcgtcgaggac
cccgacctccccgcctacttcctcgcctccaccccggtcgaccagctcgccgacctccac
ctgggctcacggccctcccgccgccccggctccggcgtctccctcgacggcctccgcgcc
atcccgtgggtcttcggctggacccagtcccgccagatcgtccccggctggtacggcgtc
ggctccggcctcaaggccctccgcgaagccggactcgacaccgtcctcgaagagatgcac
gagcactggcacttcttccgcaacttcctctccaacgtggagatgaccctcgccaagacc
gacctgcgcatcgcccggcactacgtcgacaccctcgtccccgacgagctgaagcacgtc
ttcgacgccatcgaggccgaacacgccctcaccgtcagcgaagtcctcaaggtcaccggc
tccaccgaactcctcggcaccagcccggcactccagcagaccttcgccatccgcgacgcc
tacctcgacccgatctcctacctccaggtctccctgctggcccgccagcgccaggccgcc
gaacgcggcgaagagcccgacccgctcctctcccgcgccctgctgctcaccgtcaacggt
gtcgcggcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system