KEGG   Kitasatospora albolonga: B7C62_14605Help
Entry
B7C62_14605       CDS       T05009                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kab  Kitasatospora albolonga
Pathway
kab00250  Alanine, aspartate and glutamate metabolism
kab00410  beta-Alanine metabolism
kab00430  Taurine and hypotaurine metabolism
kab00650  Butanoate metabolism
kab01100  Metabolic pathways
kab01110  Biosynthesis of secondary metabolites
kab01120  Microbial metabolism in diverse environments
kab02024  Quorum sensing
Module
kab_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B7C62_14605
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B7C62_14605
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B7C62_14605
   00430 Taurine and hypotaurine metabolism
    B7C62_14605
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B7C62_14605
Enzymes [BR:kab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B7C62_14605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ARF73364
UniProt: A0A1V0V7B2
LinkDB All DBs
Position
3375372..3376799
Genome map
AA seq 475 aa AA seqDB search
MPLHRGAHPQRDEHSEERLRLALNPFYGEADPTGAMNTAPPRHKLPDGPLPPLTAYRLVH
DELMLDGNSRLNLATFVTTWMEPQAGVLMGECQDKNMIDKDEYPRTAELERRCVAMLADL
WHAPDPATAVGCSTTGSSEACMLAGLALKRRWAKRNADRYPATARPNLVMGVNVQVCWEK
FCNFWEVEARQVPMDGERFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALD
ALQERTGLDIPVHVDGASGAMVAPFLDPDLTWDFRLPRVSSINTSGHKYGLVYPGVGWAL
WRTSDELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGRDGYRAVQQSARD
VARGLSRSVEELGDFRLLTRGDELPVFAFTTNPDVHAYDVFDVSRRLREHGWLVPAYTFP
ANRQDLSVLRVVCRNGFSSDLAALLIEDLKLLLPELRAQKHPLSHDRAVRTAFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccaccgaggcgcccacccgcagcgggacgaacactccgaggagcggctccgg
ctcgccctcaaccccttctacggcgaggccgatccgacgggggcaatgaacaccgcgccg
ccccggcacaagctccccgacgggccgctgccgccgctgacggcgtaccggctggtccat
gacgagctgatgctcgacggcaactcccggctcaacctggccactttcgtcaccacctgg
atggagccgcaggccggggtgctgatgggcgagtgccaggacaagaacatgatcgacaag
gacgagtacccgcgcaccgccgaactggagcggcggtgcgtggcgatgctcgccgacctg
tggcacgcgcccgatccggcgacggccgtggggtgttcgaccaccgggtcgagcgaggcg
tgcatgctggccgggctcgccctgaagcgccgctgggccaagcggaacgcggaccgctat
ccggcgaccgcccggcccaatctggtgatgggcgtcaacgtgcaggtctgctgggagaag
ttctgcaacttctgggaggtggaggcccggcaggtcccgatggacggcgagcgcttccat
ctcgacccgcaggccgccgccgagctctgcgacgagaacaccatcggggtcgtcggcatc
ctcggctccaccttcgacggttcctacgagcccatcgccgacctctgcgcggccctggac
gccctccaggaacgcaccggcctcgacatccccgtccatgtcgacggggcctcgggcgcc
atggtggcccccttcctcgacccggacctgacatgggacttccggctgccgagggtgtcg
tcgatcaacacctcgggccacaagtacgggctggtgtacccgggggtcggctgggccctg
tggcgtacgtcggacgagctgccggaggagctggtcttccgggtcaactacctgggcggc
gacatgccgaccttcgcgctgaacttctcccggcccggggcgcaggtggtggcgcagtac
tacacgttcctgcgcctgggacgtgacggctaccgggcggtccagcagtccgcccgggac
gtggcgcgcgggctgtcccggtcggtggaggagctcggggacttccggctcctcacccgg
ggcgacgagctgccggtcttcgccttcacgacgaacccggacgtccacgcgtacgacgtg
ttcgacgtctcccgccgactgcgggagcacgggtggctggtcccggcctacaccttcccc
gccaaccggcaggacctgtcggtgctgcgggtggtgtgccgcaacgggttctcctccgac
ctggccgccctgctgatcgaggacctgaagctgctgctccccgaactgcgcgcgcagaaa
catccgttgagccatgaccgggcggtccggacggccttccaccactga

DBGET integrated database retrieval system