KEGG   Kitasatospora albolonga: B7C62_18885
Entry
B7C62_18885       CDS       T05009                                 

Definition
(GenBank) asparagine synthase
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
kab  Kitasatospora albolonga
Pathway
kab00331  Clavulanic acid biosynthesis
kab01100  Metabolic pathways
kab01110  Biosynthesis of secondary metabolites
Module
kab_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    B7C62_18885
Enzymes [BR:kab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     B7C62_18885
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC
Other DBs
NCBI-ProteinID: ARF74079
UniProt: A0A1V0V9H0
LinkDB
Position
4342810..4344333
AA seq 507 aa
MSEQPFPAAYGFLASARTGGGQDPEAPRFATRGRYSELSERLRAQSVRFTLVHPGDDTSG
AYATGADTLVVLAGEIYNRAEIDTVLDRAAASDAERVLGLVERYGLHAFRLVNGRFAAFV
AEGERVLLATDHSGSVPLYTRRTAGQVLAATEAKTLAAPHQGDLGFPAGGARRVRRLPGL
HQVPAGSVLEIDTGRGTAETHRTWVPPVSRRIMSEEAAVDAVRHALEKAVARRLAPAAPP
LVVLSGGIDSSGVAALADAAVLGPIDTLSMGTDRSDEFPQARVVADHLGSRHREITIPTS
ELLAQLPHTLHAAESLDAEVIEYLLPLTALYRRLEGPARRVLTGYGADIPLGGMHREDRL
PQLDTAVAFDMDTFDGLNEMSPVLSTASGHWSTHPYWDREVLELLTVLEAGLKRRYGRDK
WVLRAAMGDVLPQETVVRPKLGVHEGSGTTSGFTLLVREAGVPEAGVAAAKTAVVEELFD
RIVVGGEEPDRVDLPEVVEKVAKAVKG
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtccgagcagcccttcccggctgcctacggcttcctggcctccgcccgcacgggcggg
ggccaggacccggaggcaccgcgattcgccacgcgcggccggtacagcgagctctccgag
cggctgcgcgcccagtccgtccgcttcaccctcgtccatcccggcgacgacacgtcgggg
gcgtacgcgacgggcgcggacacccttgtcgtcctcgccggggaaatctacaaccgcgcc
gagatcgacacggtcctcgaccgtgcggcggcctcggacgccgagcgggtcctcggcctg
gtcgagcggtacggactgcacgccttccgcctcgtcaacggccgcttcgccgcgtttgtc
gccgagggcgagcgcgtcctgctcgccaccgaccactccgggtccgtccccctctacacc
cgcaggaccgccgggcaggtcctcgccgccaccgaggcgaagaccctggcggcaccgcac
cagggcgacctgggcttccccgcgggcggcgcgcggcgcgtccgcaggctgcccgggctc
caccaggtgcccgccggatcggtcctggagatcgacaccgggcgcggcacggccgagacc
caccgcacctgggtgccgccggtctcccggcggatcatgagcgaggaggcggcggtcgac
gccgtccggcacgcgctggagaaggcggtcgcccgcaggctggctccggcggcgcccccg
ctggtggtcctctccggcggcatcgactcctccggtgtcgcggcgctcgccgacgcggcc
gtgctcggcccgatcgacaccctgtccatggggacggaccgttcggacgagttcccgcag
gcccgggtcgtcgccgaccacctgggctcccggcaccgcgagatcaccatccccacctcg
gagctgctcgcccagctgccgcacactcttcacgcggcggagtccctggacgccgaggtc
atcgagtacctgctgccgctcaccgccctctaccggcggctggagggcccggcccgccgg
gtgctcacggggtacggggcggacatcccgctcggcgggatgcaccgggaggaccggctg
ccgcagctcgacaccgcggtcgccttcgacatggacaccttcgacggcctcaacgagatg
agcccggtcctgtcgacggcctccggccactggtcgacccacccctactgggaccgcgag
gtcctggaactgctcaccgtgctggaggccggtctcaaacgccgttacgggcgggacaag
tgggtcctgcgcgcggcgatgggcgacgtcctcccgcaggagaccgtcgtccggccgaag
ctcggcgtccacgaggggtcaggcacgacctccgggttcaccctcctcgtccgtgaggcg
ggggtccccgaggcgggcgtcgccgccgccaagacggcggtggtggaggagctcttcgac
cggatcgtggtgggcggcgaggagccggaccgggtggacctgccggaagtggtcgagaag
gtggcgaaggcggtgaagggatga

DBGET integrated database retrieval system